KEGG   Lutibacter profundi: Lupro_05250Help
Entry
Lupro_05250       CDS       T04235                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
lut  Lutibacter profundi
Pathway
lut00511  Other glycan degradation
lut00520  Amino sugar and nucleotide sugar metabolism
lut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lupro_05250
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Lupro_05250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lut03110]
    Lupro_05250
Enzymes [BR:lut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Lupro_05250
Chaperones and folding catalysts [BR:lut03110]
 Intramolecular chaperones
  Others
   Lupro_05250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AMC10685
UniProt: A0A0X8G611
Position
complement(1171603..1173183)
Genome map
AA seq 526 aa AA seqDB search
MTLTKYLNTITIFFLVALLTSCKENPKMNLLNEVLLPKPVSVKPTGSSFELTRNTKILIK
GDSKKLLENGKYLANLLKPATGFNLEVQTTSKKAISNSIYLVITTQESNYGDEGYSLNIT
EKHIIIKANTAKGIFRGVQTLRQIFPSEIEAADYQNRKWFIASGEIYDYPQFTYRGAMLD
VTRHFFKKEDVKKYIDMIAMYKLNVLHLHLSDDQGWRIEIKSWPNLTTYGGSTEVGGGKG
GFYTQEDYKEIVKYAQQRYITVIPEIDMPGHTNAALVSYPELNCDGKATKLYTGMKVGFS
TLCTNKEITYRFVNDVIRELSEITPGPYIHIGGDESHSTKIEDYIPFINRVQEIVIANKK
KVIGWDEIVSAALKPATIVQYWGRPKNALKGVSKNAKIILSPSDRTYLDMKYDSVTKLGL
KWAGYVDIDKAYNWNPSTLISGITKKDILGIESPLWTETVTNMKELELMIFPRIIGHAEI
GWTPDSLRVWDDYKIRLQKHAKRLKIMKINFYPSSLIDWDEKKEKM
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacccttacaaagtatttaaatacaattactatcttttttctagtagcattattaacg
tcatgcaaagaaaatcctaaaatgaatcttttaaatgaagtgctattgccgaaacctgtt
tctgtgaagcctacaggaagttcttttgaattgacaaggaacactaaaattttaataaaa
ggagattcaaaaaaattactagaaaacggaaaatatttagcaaatttattaaaaccagct
acaggttttaatttagaagtacaaacaacttcaaaaaaagcaatttcaaatagtatttat
ttagtaattacaacgcaagaatctaattatggtgatgaaggctattctttaaatattact
gaaaaacatataattataaaggcaaatactgccaaaggtatttttagaggagttcaaaca
cttcgtcaaattttcccttctgaaattgaagcagctgattaccaaaacagaaagtggttt
attgcttctggtgaaatttacgactacccacaatttacgtatagaggtgctatgttagat
gtaactcgacatttttttaagaaggaagatgtaaaaaaatatatagatatgatagcaatg
tacaaattaaatgtacttcatttacacttgtctgatgatcaaggatggcgaattgaaatt
aaatcttggccaaatttaacaacttatggaggctcaactgaagttggaggtggtaaaggc
ggtttttatacacaagaagattataaagaaattgtaaagtatgcacagcaaagatatata
acggttattcctgagattgatatgccaggacatacaaatgccgctttagtatcgtaccca
gaattgaattgcgatgggaaagcaacaaaactatatacaggaatgaaagttgggtttagt
accttatgtaccaataaagaaattacctatagatttgtaaatgatgtaattagagaatta
tcggaaataacaccaggtccgtatattcatattggaggagatgaatcacattcaacaaaa
attgaagattatattccttttataaatagagtacaagaaatagtaattgctaataaaaaa
aaggtaataggatgggatgaaattgtgagtgcagctctaaaaccagcaaccatagttcaa
tattggggaagacctaaaaatgcgttaaaaggtgtatcaaaaaatgcgaaaattattcta
tctccaagtgacagaacttatttagatatgaaatatgattctgttacaaaacttggtttg
aaatgggcagggtatgttgatattgataaagcatataactggaatccgtcaaccttaatt
tcaggaatcactaaaaaagatattttaggaatagaatcaccattgtggacggaaaccgtt
acaaatatgaaggagctagaattgatgatttttcctcgaattattggacacgcagaaatt
ggatggacaccagattctttaagagtttgggacgattataaaataagattacaaaaacat
gccaagcgattaaaaataatgaaaattaacttttatccttcatcattgattgattgggat
gaaaaaaaggagaaaatgtaa

DBGET integrated database retrieval system