KEGG   Lutibacter profundi: Lupro_05695Help
Entry
Lupro_05695       CDS       T04235                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lut  Lutibacter profundi
Pathway
lut00900  Terpenoid backbone biosynthesis
lut01110  Biosynthesis of secondary metabolites
lut01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lut00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lupro_05695
Enzymes [BR:lut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Lupro_05695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AMC10762
UniProt: A0A109RNQ2
Position
complement(1271828..1273102)
Genome map
AA seq 424 aa AA seqDB search
MSKAVNGFSKLSKLEKIDWLASNFFNEAKKNKEILKQYWNSNEVLQNLHDDFIENTISNF
YMPFAIAPNFVINGKIYAIPMVIEESSVVAAASLVAKFWSTRDGFKAKVISTTKIGQVHF
MYEGNKQELYDYFSSKKSALFSVTEEITKNMRKRGGGILEIELRDKTEDLANYYQLHVTF
ETVDSMGANFINSCLEAISNEFKKEDTQIVMSILSNYVPECLVRAEVSCKVDDLYAENAE
ILSQKFVQAIQIANAEPHRAVTHNKGIMNGVDAVVLATGNDFRAIEAGAHAYASKSGKYK
SLTNASIENGTFKFWIEIPLALGTVGGLTKLHPLSKLALELLGNPSAKELMEIIAVAGLA
QNFAALRALTTTGIQKGHMKMHLTNIIKQLGASEEEKAFLINYFENKTVTHNAVVEAYNK
LTGG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagctgttaatggattttcaaaattaagtaagttagaaaaaatagattggtta
gcctcaaatttttttaatgaagctaaaaaaaataaagaaattttaaagcaatattggaac
tcaaatgaagtattacaaaatttacacgatgattttatagaaaataccatttctaatttt
tatatgccatttgctatagcacctaattttgtaattaatggaaaaatatatgcaattcca
atggttatagaggaaagctcggtagtagctgcagcttcattggttgctaagttttggagt
acacgtgacggatttaaagcaaaagtgatttcaactaccaaaattggacaagttcatttt
atgtatgaaggtaataagcaggaactttatgattatttctcttcgaaaaagagtgcatta
ttttctgttactgaagaaattaccaaaaatatgcgtaaacgtggtggaggaattttagag
atagaattgagagataaaacagaagatttagcaaactattatcaattacatgttactttt
gaaacggttgatagtatgggggcaaattttataaattcatgtttagaagctatttcaaat
gaatttaaaaaagaggacactcaaatagtaatgagtattttatctaactacgttcctgaa
tgtttggtccgtgctgaggttagttgcaaggttgacgatttatatgcagaaaatgctgag
atattatctcaaaaatttgtccaagcaatacaaattgcaaatgcagaacctcatagagca
gttacgcataacaaagggattatgaatggagttgatgccgtggttttagcaacaggaaac
gattttagagctattgaagccggagctcatgcatacgcttcaaaaagcggaaaatataag
agtttaaccaatgcatctattgaaaatggcacttttaaattttggattgaaattccttta
gcattaggaactgttggtggattaacaaaattacatccattatcaaaattagcgctagaa
ttacttggaaacccttcagcaaaggaattaatggaaattattgctgtagcaggactagca
caaaattttgcagctttaagagcattaaccactacaggaatccaaaaaggacatatgaaa
atgcacttaacaaatattattaaacaattaggtgctagcgaagaagaaaaagcattctta
atcaattattttgaaaataaaacagtaacacataatgcggttgttgaagcgtataataag
ttgactggcggctga

DBGET integrated database retrieval system