KEGG   Lipotes vexillifer (Yangtze River dolphin): 103068417Help
Entry
103068417         CDS       T03090                                 

Definition
(RefSeq) c-X-C chemokine receptor type 2-like
  KO
K04175  C-X-C chemokine receptor type 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
lve04061  Viral protein interaction with cytokine and cytokine receptor
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    103068417
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103068417
   04061 Viral protein interaction with cytokine and cytokine receptor
    103068417
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103068417
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103068417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lve04030]
    103068417
   04050 Cytokine receptors [BR:lve04050]
    103068417
   04090 CD molecules [BR:lve04090]
    103068417
G protein-coupled receptors [BR:lve04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    103068417
Cytokine receptors [BR:lve04050]
 Chemokine receptors
  CXC Chemokine
   103068417
CD molecules [BR:lve04090]
 Proteins
  103068417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF621
Motif
Other DBs
NCBI-GeneID: 103068417
NCBI-ProteinID: XP_007451494
UniProt: A0A340WWN2
Position
Un
AA seq 334 aa AA seqDB search
MTIILNDLFNYTDLWQLFEDEFANFTGTPPTEERHYSPCKMDTETLNKYAVVVIYALVFL
LMNLAMADLLFALTLPIWATSKAKGWIFGTALCKVVSLLKEVNFYSGILLLACISVDRYL
AIVHATRTLTQKRHWVRFICLGIWVLSLILALPIFVFREAYQPPYSSPVCYEDMGANTTK
WRMVMRVLPQSFGFLLPLLVMLICYGLTLRTLFAAHMGQKHRAMRVIFAVVLVFLLCWLP
YNLVLVADTLMRVRVIAETCERRNDIGRALDATEILGFLHSCLNPLIYVFIGQKFRHGLL
RIMAIHGLVSKEFLVKDSRPSFVGSSSGNTSTTL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactatcatcctgaatgatttatttaattacactgatttgtggcagttgtttgaggat
gagtttgcaaatttcactggcacgccacccacagaagaacgtcattatagtccctgtaag
atggacactgagacgctcaacaagtatgccgtggtcgtcatctatgccctggtcttcctg
ctgatgaacctggccatggctgacctgctctttgccctgaccttgcctatctgggccacc
tccaaggcaaagggctggatctttggcacagccctgtgcaaggtggtctcactcctgaag
gaagtcaacttctacagtggtatcctactgctggcctgcatcagcgtggaccgctacctg
gccattgtccatgccacacgcacgctcacccagaagcggcactgggtcaggttcatatgt
ttaggcatctgggtcctgtccttgatcctggccctgcccatcttcgtcttccgtgaggct
tatcaaccaccctattccagcccagtctgctacgaggacatgggtgccaatacaacgaag
tggcggatggtgatgcgggtcctgccccagtcttttggcttcctcctgcccctgctggtc
atgctcatctgctacggactcaccctgcgcacgctctttgcagcccacatggggcagaag
caccgggccatgcgggtcatctttgctgtcgtgctcgtcttcctgctctgctggctgccc
tacaacctggtcctggttgcagacaccctgatgagggtccgggtgatcgcggagacctgt
gagcgccgcaatgacatcggccgggccctggatgccaccgagatcctgggcttcctccac
agctgcctcaatcctctcatctacgtcttcattggccagaagtttcgccacggactcctc
aggatcatggccatccacggcctggtcagcaaggagttcttggtcaaggacagcaggcct
tccttcgtcggctcttcttcagggaacacctctactaccctctga

DBGET integrated database retrieval system