KEGG   Lipotes vexillifer (Yangtze River dolphin): 103069759Help
Entry
103069759         CDS       T03090                                 

Gene name
ACSL4
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00061  Fatty acid biosynthesis
lve00071  Fatty acid degradation
lve01100  Metabolic pathways
lve01212  Fatty acid metabolism
lve03320  PPAR signaling pathway
lve04146  Peroxisome
lve04216  Ferroptosis
lve04714  Thermogenesis
lve04920  Adipocytokine signaling pathway
Module
lve_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103069759 (ACSL4)
   00071 Fatty acid degradation
    103069759 (ACSL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103069759 (ACSL4)
  09143 Cell growth and death
   04216 Ferroptosis
    103069759 (ACSL4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103069759 (ACSL4)
   03320 PPAR signaling pathway
    103069759 (ACSL4)
  09159 Environmental adaptation
   04714 Thermogenesis
    103069759 (ACSL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lve01004]
    103069759 (ACSL4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103069759 (ACSL4)
Enzymes [BR:lve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103069759 (ACSL4)
Lipid biosynthesis proteins [BR:lve01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103069759 (ACSL4)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103069759 (ACSL4)
  Exosomal proteins of breast cancer cells
   103069759 (ACSL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C CelTOS
Motif
Other DBs
NCBI-GeneID: 103069759
NCBI-ProteinID: XP_007463735
UniProt: A0A340XX12
Position
Un
AA seq 670 aa AA seqDB search
MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREI
LSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGSGLAALGLKPKSTIAIFCETRA
EWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEATYLITSVELLESKLKTALLDINC
VKHIIYVDNKTINKAEYPEGFEIHSMQSVEELGSKPENSSVPPNRPTPSDLAIVMYTSGS
TGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIG
YSSPLTLSDQSSKIKKGSKGDCTVLKPSLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFK
IGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTQRFMNVCFCCP
VGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVI
GGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGE
YVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQQRLTLLAQQKGVEGTWVDICN
DPAMEAEILKEIREAANTMKLERFETPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYL
KDIERMYGGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaataaaagctaagcccacctcagacaaacctggaagtccgtatcgctct
gtcacgcacttcgactcactagctgtcatagacatccctggagcagacaccctggataaa
ttattcgatcatgccgtatccaagtttggcaagaaggacagcctggggaccagggaaatc
ctaagtgaagaaaatgaaatgcagccaaatggaaaggtttttaagaagttaattcttggg
aattataaatggatgaactatctcgaagtgaaccgcagagtgaataactttggtagtgga
ctcgctgcattgggactgaaaccaaagagcactattgccattttctgtgagaccagggct
gaatggatgattgcagcgcagacctgctttaagtacaactttcctcttgtgactttatat
gccacacttggcagagaagctgtagttcacgggttaaatgaatctgaggctacctatctg
attactagtgttgaacttctggagagtaaacttaagactgcattgttagatattaactgt
gttaaacatatcatttatgtggataataagacgatcaataaggcagaataccctgaagga
tttgagattcacagcatgcaatcagtagaagagttgggatccaagccggaaaactcaagc
gttcctccaaatagaccaactccttcggacttggctatcgtcatgtataccagtggttct
actggccgacctaagggagtgatgatgcatcatagcaatttgatagctggaatgacaggc
cagtgtgagagaattcctggactgggaccaaaggacacatatattggctacctgcctttg
gctcatgtactagaactgacagcagagatatcttgttttacctatggttgtaggattgga
tattcttctccgcttactctctctgaccagtccagcaaaattaaaaaggggagcaaagga
gactgtactgtactgaagccttcgctcatggcagctgtcccggaaatcatggatagaatt
tataagaatgttatgagcaaagtccaagagatgaattatatccagaaaactctgttcaag
atagggtatgattacaaattggaacagatcaaaaagggatatgatgcaccgctttgcaat
ctgatactgtttaaaaaggtgaaggctctgctaggagggaatgtccgtatgatgctgtct
ggtggagcacccctgtctccgcagacacaacgattcatgaatgtctgcttctgctgcccg
gttggtcagggttatggactgacagaatcgtgtggtgctggcacagttactgaagttact
gactatactactggcagagttggcgcccctcttatttgctgtgaaattaagctaaaagac
tggcaggaaggtggttatacagttcacgacaaaccaaaccccaggggtgaaattgtaata
ggtggacagaatatctccatgggatattttaaaaatgaagagaaaacagctgaggattat
tctgtggacgaaaatggccaaaggtggttttgcactggtgatattggagaattccatccc
gatgggtgtttacagattatcgatcgtaagaaagatctggtgaagttacaagcaggggaa
tatgtatctcttgggaaagtagaagctgcactgaagaactgtccacttattgacaacatc
tgtgcttttgccaaaagtgaccagtcctatgtgataagttttgtggttcctaatcagcaa
aggttgacgcttttggcacaacagaaaggggtggaaggcacttgggttgatatctgcaat
gaccctgccatggaagctgaaatactgaaagagattagagaagctgcaaataccatgaaa
ttggagcgatttgaaactccaatcaaggttcgcttaagcccagagccctggacccctgaa
actggtttggtcactgatgctttcaaactgaaaaggaaggaactgaagaaccattacctc
aaagacatcgagcgaatgtatgggggcaaataa

DBGET integrated database retrieval system