KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070184
Entry
103070184         CDS       T03090                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103070184 (AHRR)
Transcription factors [BR:lve03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103070184 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 103070184
NCBI-ProteinID: XP_007471990
UniProt: A0A340YKH6
Position
Un
AA seq 691 aa
MIPPGECLYAGRKRRKPIQKQRPAVGAERSNPSKRHRDRLNAELDRLAGLLPLPPDIVSK
LDKLSVLRLSVSYLRVKSFFQVTQEXTLQQPAAGAPSPEDRDPCGGSAVLEGRLLLESLH
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
GCGQNLLSETGEDAVLGRLLRAQEGAAGWPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKRRAPSGAALPPRLSLFCVVAPLPAAVKMQSVCLRAKQRVDTSATPDTKA
KAAASLCEPELHGKPSYLAGRSSGGNGLSVFRRPADACHWGRLATRGPCLCLRGGHDLLH
PHPEGAAGDGRGEELGGLPRGPSCPRERRDIPPYSCHLETQGPSKHLNWTPGRHGQDGGT
KLKLEPGKGDPFPAVQARGACLPYPGTQGTVHAVRSSPGSHQPKPPPGPCTSRTSRALRD
GHQGQAPLPTSCPFPQGSLEDGLPRPGGQRLPAGCYPTEDKLRGIPMPPGAPGNPILSLD
VPIKMESESGSEDAADGYCVSPSQAWLAASDVAKRQMHLKMEPDSRHPLYSPPLGPGLLG
AHPRPSRELAPLPPAHCACLEPPPRLCAGGHQPPSLGCDCQAPGPAPVVKLEPLDSPPWA
AHSQGGAPGMLPRSALATRMPPRDPECTFLP
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggagtgcctgtatgcggggaggaaacgaaggaagcccattcagaaa
cagaggcccgccgtgggcgccgagaggtcgaacccttccaagagacaccgggatcgcctc
aacgccgagctggaccgcctagccggcctgctgccactgccccccgacatcgtctctaag
ctggacaagctttcggttctgcgcctcagcgtcagttacctccgggtgaagagcttcttt
caagtaacccaggagtgaaccctgcagcagccggcggccggtgccccctcaccagaagac
agggatccgtgtggagggtctgccgtgctggagggaaggctgctgctggagtccctccac
ggctttgctctggtggtaagcgcggaagggatgatattctacgcgtcagcaacgattgtg
gactatctgggcttccaccagacggacgtgatgcaccaaaatatttacgactacatccac
gtggacgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggct
gggtgtgggcagaacctgctctcagagacaggagaggatgccgtcctggggaggctgctc
cgggcccaggagggggccgcgggctggcccaccgagtactcggccttcctgacccgatgc
ttcatctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caagggaaactgaaattcctgttcgggcagaagaggagggccccgtcgggagccgccctg
ccccctcggctctccctgttctgcgtcgtggcgcccctgcctgctgcggtgaagatgcag
agtgtgtgtctgagggcgaaacagagggtggacacctctgccacgccggacacaaaagca
aaagctgccgcaagtctctgtgaaccagaattgcacggaaaacccagttacttagcaggg
aggagcagcggaggaaacggcctgtccgtgttcaggaggcccgcagacgcctgccactgg
ggccggctggcaacccggggcccctgcctgtgcctgcggggcggccacgacctcctccac
ccccaccccgagggggccgcaggggatgggcgaggagaggaactgggggggctgccgagg
ggcccctcctgcccaagggagcggagggacatccccccgtacagctgccacctcgagaca
cagggaccctcgaagcacctgaactggacgccggggagacacggtcaggacggcggcacc
aagctgaagctggagcccggcaagggtgacccattccccgccgtgcaggcccgtggcgcc
tgcctgccctacccgggcacccagggcactgtccacgccgtcaggagttcacctggctct
caccagccaaagcctccccctgggccctgcaccagccggaccagcagagccttgcgggat
ggccaccagggccaggcaccccttcccaccagctgccccttccctcaggggagcctggag
gacgggcttcctcggccgggagggcagcgtctccccgcggggtgctatcccaccgaggac
aagcttcgaggcatcccaatgcccccgggagccccaggtaaccccatattgtcactcgat
gtgcccatcaagatggagagcgaatccgggtccgaggatgcggcggatggctactgtgtg
tccccgagccaggcgtggctggcggccagcgacgtggccaagagacaaatgcacctgaag
atggagccggactccaggcaccccctctacagcccacccctggggcccggcctgctgggg
gcccaccccaggcccagcagggagctggccccgttgccccccgcacactgcgcctgcctg
gagcctccgccccgcctctgtgctgggggccaccaaccccccagcctgggctgtgactgc
caggctcccgggcctgcgcccgtagtcaagctcgagcccctggactcgcccccgtgggcc
gctcacagccagggtggggcgcccgggatgctccccaggagtgccttggcgacacggatg
ccacccagagaccccgagtgcacgttcctgccgtag

DBGET integrated database retrieval system