KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070515
Entry
103070515         CDS       T03090                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103070515 (RDH5)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103070515 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 103070515
NCBI-ProteinID: XP_007467829
UniProt: A0A340Y7U4
Position
Un
AA seq 318 aa
MWLPLLLGVSLWAALWLLRDRQSLPASDAFVFVTGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLERVASSRLHTTLLDVTDPQSIRQAAKWVETHVRETGLFGLVNNAGMAGIIGP
TPWQTQEDFQRVLNVNTLGPIGVTLALLPLLRQAQGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLESLEDSLQACWARLPPATQALYGES
FLTKYLRVQQRIMNLICDPDLTKVSKCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggagtctcgctctgggcagcactgtggttgctcagggac
cggcagagcctgcccgccagcgatgctttcgtctttgtcaccggctgtgactcgggcttt
gggcggcttctggcactgaggctggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctcgagcgggtggcctcctcccgactccacaccaccctg
ctggatgtcacagatccccagagcatccggcaggcagccaagtgggtggaaacacacgtc
agggaaacagggctttttggtctggtgaataatgccggcatggctggcatcatcgggccc
acaccttggcagacacaggaggatttccagcgggtgctgaatgtgaacacactgggtccc
atcggggtcaccctcgccctgctgcccctgctgcggcaggcccagggccgggtgatcaac
atcaccagtgtcctgggccgcctggcagccaatggagggggctactgtgtctccaagttt
ggcctggaggcgttctctgacagcctgaggcgggacgtggctcctttcggggtacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgacaaacctggaaagtctggaggac
agcctgcaggcctgctgggcacggctgcctccagccacacaggccctctatggggagagc
ttcctcaccaaatatctgagagtgcagcagcgcatcatgaacctgatctgtgacccggac
ctgaccaaggtgagcaagtgcctggagcatgccctcactgcccgtcaccccagaacccgc
tacagcccaggctgggacgccaagctgctctggctgccagcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgctcaggcggtctactga

DBGET integrated database retrieval system