KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070610Help
Entry
103070610         CDS       T03090                                 

Definition
(RefSeq) glutathione S-transferase P-like
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00480  Glutathione metabolism
lve00980  Metabolism of xenobiotics by cytochrome P450
lve00982  Drug metabolism - cytochrome P450
lve00983  Drug metabolism - other enzymes
lve01100  Metabolic pathways
lve01524  Platinum drug resistance
lve05200  Pathways in cancer
lve05204  Chemical carcinogenesis
lve05215  Prostate cancer
lve05225  Hepatocellular carcinoma
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103070610
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103070610
   00982 Drug metabolism - cytochrome P450
    103070610
   00983 Drug metabolism - other enzymes
    103070610
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103070610
   05204 Chemical carcinogenesis
    103070610
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103070610
   05215 Prostate cancer
    103070610
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103070610
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103070610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lve02000]
    103070610
Enzymes [BR:lve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103070610
Transporters [BR:lve02000]
 Other transporters
  Pores ion channels [TC:1]
   103070610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 103070610
NCBI-ProteinID: XP_007450482
UniProt: A0A340WS99
Position
Un
AA seq 237 aa AA seqDB search
MQPQGGRAGALSPVTHLSQTLTDFSLPPAVPPYTIVYFPVRGRCEAMRMLLADQDQSWKE
EVVTMETWPSLKASCLYGQLPKFQDGDLTLYQSNAILRHLGRSLGLYGKDQREAALVDVV
NDGVEDLRCKYVTLIYTNYEAGKDDYVKALPQHLKPFEALLSQSQGGQAFIVGNQISFAD
YNLLDLLRIHQVLAPGCLDSFPLLSAYVARLSARPKLQAFLASPEHVNRPINGNRKQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccccagggaggacgagcgggcgccctctcccccgtaacacacctctcgcagacg
ctaacagacttctctctgcctcctgcagtgccgccctacaccatcgtctacttccctgtt
cgagggcgctgcgaggccatgcgcatgctgctggccgaccaggaccagagctggaaggaa
gaggtggtgaccatggagacctggccgtcactcaaggcctcctgtctgtacgggcagctc
cccaagttccaggatggagacctgaccctgtaccagtccaatgccatcttgcgtcacctg
ggccgctccctcgggctgtatgggaaggaccagcgggaggcagccctggtggacgtggtg
aatgacggcgtggaggaccttcgctgcaaatatgtcaccctcatctacacaaactacgag
gcgggcaaggatgactacgtgaaggcactgccccagcacctgaagccttttgaggccctg
ctgtcccagagccagggcggccaggccttcatcgtgggcaaccagatctccttcgctgac
tacaacctgctggacctgctgcggattcaccaggtcctggcccctggctgcctagactcc
ttccccctgctctcagcctacgtggcccgcctcagcgcccggcccaagctgcaggccttc
ctggcctccccggagcacgtgaaccgccccatcaatggcaacaggaaacagtga

DBGET integrated database retrieval system