KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070851
Entry
103070851         CDS       T03090                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00100  Steroid biosynthesis
lve01100  Metabolic pathways
Module
lve_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103070851 (TM7SF2)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103070851 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103070851
NCBI-ProteinID: XP_007462080
UniProt: A0A340XSM2
Position
Un
AA seq 417 aa
MAPQGSRAELEFGGPLGAAALLLLLPATMFHLLLVARSGPARLLGPPPYLPELEELWSPW
ALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGVLAGL
PLSALPEMLLPLAFAATLIAFIFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELNP
RICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWHE
EAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPEPLGLPLASVICLINAVGY
YIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALAW
SLPCGVSHLLPYFYLLYFTALLAHREARDEQQCLQKYGLAWHAYCRRVPYRIVPYIY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcccctcagggctcccgggctgagctggaattcggaggacccctgggcgctgcggca
ctgctgctgctgctccccgccaccatgttccacctgctactggtagcccgctcgggccca
gcgcgcctcctgggcccacccccttacctgccggaactcgaggagttgtggagcccgtgg
gcgctgttgctgtgtctcacctggctcggcctgcaggcggcgctctacctcttgccggcg
cgcaaggtggccgaggggcaggaactgaaggacaagagtcgactgcgctaccccattaac
ggcttccaggccctggtgctgacagccctgttggtgggcctgggagtgttagccgggctg
cccctgagcgcgctcccggaaatgctcctgcccttggcctttgcggctaccctcatcgcc
ttcatcttcagcctccttctctacctgaaggctctggtagcccctgcctctgccctggca
cccggggggaactcaggcaatcccatttacgactttttcctgggacgggagctcaacccg
cgcatctgttcctttgacttcaaatatttctgcgaactgaggcctggcctcatcggctgg
gtcctcatcaacctggcattgctgatgcaggaagcagaacttcgggggagtccctcactg
gccatgtggctggtcaatggcttccagctactatatgtgggtgatgccctttggcacgag
gaggcggtcctcaccaccatggacatcatacatgacgggtttggcttcatgctggccttt
ggggacctcgcctgggtacccttcacctacagcctgcaggcccagttcctgctgtaccac
ccagagcccctggggttgcccctggcctcggtcatctgcctcatcaatgctgttggttac
tacatcttccgtggagccaattctcagaaaaacaccttccggaagaatccttctgatccc
agagtggctgaccttgagaccatctctacagccacagggcgacggctgctggtgtctggg
tggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcctgg
tccttgccctgcggggtgtcccacctgttgccctacttctatctcctttacttcactgcg
ctgttggcacaccgtgaggcccgggacgagcagcagtgtctgcagaagtatggcctggcc
tggcatgcatactgccggcgcgtgccctaccgaatcgtgccctacatctactga

DBGET integrated database retrieval system