KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071330
Entry
103071330         CDS       T03090                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve00240  Pyrimidine metabolism
lve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103071330 (DCK)
   00240 Pyrimidine metabolism
    103071330 (DCK)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103071330 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 DUF932 CoaE
Other DBs
NCBI-GeneID: 103071330
NCBI-ProteinID: XP_007446163
UniProt: A0A340W9Q4
Position
Un
AA seq 260 aa
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccatctcccgcagccagctctgagggcacccgc
atcaagaaaatttccatcgaagggaacattgctgccgggaagtcaacatttgtgaatatc
cttaaacaagtctgtgaggattgggaagtggttcctgaacctgttgccaggtggtgcaat
gttcagagtactcaggatgaatttgaggaactgacaacgtctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgaacggtggtctttcaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcaatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatacttagagaagcttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctggttgaaaaggtaaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system