KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073066Help
Entry
103073066         CDS       T03090                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01524  Platinum drug resistance
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04060  Cytokine-cytokine receptor interaction
lve04068  FoxO signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04217  Necroptosis
lve04650  Natural killer cell mediated cytotoxicity
lve04722  Neurotrophin signaling pathway
lve04932  Non-alcoholic fatty liver disease (NAFLD)
lve04940  Type I diabetes mellitus
lve05142  Chagas disease (American trypanosomiasis)
lve05143  African trypanosomiasis
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05162  Measles
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05165  Human papillomavirus infection
lve05168  Herpes simplex virus 1 infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05320  Autoimmune thyroid disease
lve05330  Allograft rejection
lve05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103073066 (FASLG)
   04010 MAPK signaling pathway
    103073066 (FASLG)
   04068 FoxO signaling pathway
    103073066 (FASLG)
   04151 PI3K-Akt signaling pathway
    103073066 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103073066 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103073066 (FASLG)
   04217 Necroptosis
    103073066 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103073066 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103073066 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103073066 (FASLG)
   05205 Proteoglycans in cancer
    103073066 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103073066 (FASLG)
   05330 Allograft rejection
    103073066 (FASLG)
   05332 Graft-versus-host disease
    103073066 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103073066 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103073066 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103073066 (FASLG)
   05162 Measles
    103073066 (FASLG)
   05164 Influenza A
    103073066 (FASLG)
   05161 Hepatitis B
    103073066 (FASLG)
   05160 Hepatitis C
    103073066 (FASLG)
   05168 Herpes simplex virus 1 infection
    103073066 (FASLG)
   05163 Human cytomegalovirus infection
    103073066 (FASLG)
   05165 Human papillomavirus infection
    103073066 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    103073066 (FASLG)
   05143 African trypanosomiasis
    103073066 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103073066 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103073066 (FASLG)
   04052 Cytokines and growth factors [BR:lve04052]
    103073066 (FASLG)
   04090 CD molecules [BR:lve04090]
    103073066 (FASLG)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103073066 (FASLG)
Cytokines and growth factors [BR:lve04052]
 Cytokines
  Tumor necrosis fators
   103073066 (FASLG)
CD molecules [BR:lve04090]
 Proteins
  103073066 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Lectin_N
Motif
Other DBs
NCBI-GeneID: 103073066
NCBI-ProteinID: XP_007446817
UniProt: A0A340WH35
Position
Un
AA seq 262 aa AA seqDB search
MQQPLNYPYPQIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPLPPPLKKRRNHNT
GLCLLVMFFMVLVALVGLGLGLFQLFHLQKELAELRESTSQRHTESSLEKQIGHPNPSSE
KTELRKAAHLTGKRNSRSIPLEWEDTYGIALVSGVKYKKGSLVINETGLYFVYSKVYFRG
QSCNNQPLNHKVYTRNFRYPQDLVLMEGKMMDYCTTGQMWARSSYLGAVFNLTNADHLYV
NVSEPSLVNFEESKTFFGLYKL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttgaattatccgtacccccagattttctgggtggacagcagtgccagc
tctccctgggcttctccagggtcagtcttcccctgtccatcctctgtgccaggaaggccc
gggcaaaggaggccaccgccactaccaccacctctgaagaagaggaggaaccacaacaca
ggcctgtgtctccttgtgatgtttttcatggttctggtggccttggttggattggggctg
ggactatttcagctcttccacctgcagaaggaactggccgaactcagagagtccaccagc
caaaggcatacagaatcatctttggagaagcaaataggtcaccccaatccatcctctgag
aaaacggagctgagaaaggcagctcatttaacaggcaagcgcaactcaagatccatccct
ctggaatgggaagacacttatggaattgccctggtctctggggtgaagtataagaagggc
agccttgtgatcaatgaaactgggctgtactttgtttattccaaagtgtacttccggggt
cagtcctgcaacaaccagcccctgaaccacaaggtttacacgaggaactttaggtacccc
caggacctggtgctcatggaggggaagatgatggactactgcactactggccaaatgtgg
gcccgcagcagctacctgggggctgtgttcaatctcaccaatgctgaccatttatatgtc
aatgtatctgagccctctctggtcaattttgaggaatctaagacattttttggcttatat
aagctctaa

DBGET integrated database retrieval system