KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073501Help
Entry
103073501         CDS       T03090                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04260  Cardiac muscle contraction
lve04261  Adrenergic signaling in cardiomyocytes
lve04921  Oxytocin signaling pathway
lve05410  Hypertrophic cardiomyopathy (HCM)
lve05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
lve05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103073501 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103073501 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103073501 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    103073501 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    103073501 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    103073501 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    103073501 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103073501 (CACNG5)
Ion channels [BR:lve04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103073501 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DUF4199
Motif
Other DBs
NCBI-GeneID: 103073501
NCBI-ProteinID: XP_007455340
UniProt: A0A340X8I1
Position
Un
AA seq 275 aa AA seqDB search
MGACRRKALTLLSSVFAVCGLGLLGIAVSTDHWLYLEEGVVLPQNQSTETKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPVSTQLASESTVNVLKMTRSATPFPLVSLLFTFIGFILSNI
GHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVLNRTKEAETYFTYKYGWSFA
FAAISFLLTESAGVMAVYLFMKRCTAEDVYGPHPGFYRPRLSNCSDHSGQFLHPDAWARG
RSPSDISSDVSLQMNSSYPALLKCPDYRQVSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctgcaggagaaaggccctgaccctgctgagcagcgtctttgccgtgtgtggc
ctgggcctgctgggcattgcggtcagcacggaccactggctgtacctggaggagggcgtg
gtcctgccccagaaccagagcacggagaccaagatgtccctgcactcaggcctgtggagg
gtctgcttcctcgcaggtgaggagcggggacgctgcttcaccatagagtatgtgatgcct
gtgagcacccagctcgcctccgagtccacggtcaacgtgctaaaaatgacgcgctcggcc
acgccgttccccctggtcagcctcctcttcacgttcatcggcttcatcctgagcaacatt
ggacacgtccgtccccacaggacaatcctggcctttgtctccggcatcttctttatcctc
tccggcctctcgctggtggtgggcctggtgctgtacatctccagcatcaacgatgaggtg
ctcaacaggaccaaggaggcggagacctactttacctacaagtacggatggtcgtttgcc
ttcgccgccatctccttcctcctaacggagagtgcgggggtgatggccgtgtacctgttc
atgaagaggtgcaccgccgaggacgtgtacgggcctcaccccggcttctaccgcccgcgt
ctgagcaactgctccgatcactcgggccagttcctgcacccggacgcctgggcgcgaggc
cgcagcccgtccgacatctccagcgacgtctccctgcagatgaacagcagctacccagcc
ctgctcaagtgccccgactaccgccaggtgtcttcctccccctgctga

DBGET integrated database retrieval system