KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073572Help
Entry
103073572         CDS       T03090                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00010  Glycolysis / Gluconeogenesis
lve00562  Inositol phosphate metabolism
lve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103073572 (MINPP1)
   00562 Inositol phosphate metabolism
    103073572 (MINPP1)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103073572 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103073572 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 103073572
NCBI-ProteinID: XP_007470358
UniProt: A0A340YBB2
Position
Un
AA seq 485 aa AA seqDB search
MLRGPCRLCRVSVAPVAALAVALVSSLSRCSLLEPEDRVVSPLSPYFGTKTRYEDANPGL
LPDPEAPRRDPQLLETCTPVQLVALIRHGTRYPTTKQIRKLRQLHGLLQARGPGDDRIRA
AGGGDLGAALANWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPVLFSRENCGRLQLVT
SSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVER
NATALYHVEAFKTGPEMQNILKKVAGILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSPW
CDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSQSSCTLFQDIFQHLDKAVEQKQSSQPIS
SPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLYH
CKNAKTPKEEFQVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKVN
TSDEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtggcccttgccgcctctgcagggtctccgtggcacccgtcgcggccctggct
gtggcgctggtctcgtcgctctctcgctgctccctcctggagccggaggaccgcgtggtc
tcgccgctcagcccctacttcggcaccaagactcgctacgaggatgccaaccccgggctg
ctgccggaccccgaggcgccacggcgggacccacagctgctggagacctgcaccccggta
cagctggtcgccctcatccgccacggcacccgctacccgaccaccaaacaaatccggaag
ctgcggcagctgcacggactgctgcaggcccgcggtcccggggatgaccggatccgcgct
gccggcggcggcgacctgggcgctgcgctggccaactggccgctgtggtacgcggactgg
atggacgggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgcctg
gcctcccttttcccggtcctcttcagccgagaaaactgcggccgcctgcagctagtcacc
agctccaagcaccgctgcgtggacagcggcgccgccttcctgcagggactgtggcagcac
taccaccctgggttaccgccgcccgacgtcgcagacatggagtgtggacctccaagaatt
aatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaaagg
aatgctacggctctttatcatgtagaagccttcaaaactggaccagaaatgcagaacatt
ttaaaaaaagttgcaggtattttgcaagtgccagtcaacaacttaaatgcagatttaatt
caggtagcttttttcacctgttcatttgacctggcaattaaaggtgttaaatctccttgg
tgtgatgtttttgacatagatgatgcaaaggttttagaatacttaaatgatctgaaacaa
tattggaaaagaggatatgggtataccattaatagtcaatccagctgcaccctgtttcag
gatatctttcagcacttggacaaagcagttgaacagaaacaaagttctcaaccaatttcc
tctccagtcatccttcagtttggtcatgcagagacccttcttccactgctttctctcatg
ggctacttcaaagacaaggagcccctaacagcttacaattacaaggagcaaatgcatcgg
aagttccgaagtggtcacattgtaccctatgcctcaaacctaatatttgtgctttaccat
tgtaaaaatgctaagactcctaaggaagaattccaagtgcagatgttactgaatgaaaag
gtgttaccattggctcactcacaagaaactgtttctttgtatgaagatctgaagaaccac
tataaggacatccttcagagttgtcacaccagtgaagaatgtgaactaccaaaggtgaac
acatctgatgagctatga

DBGET integrated database retrieval system