KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073823Help
Entry
103073823         CDS       T03090                                 

Gene name
ACOD1, IRG1
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    103073823 (ACOD1)
Enzymes [BR:lve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     103073823 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 103073823
NCBI-ProteinID: XP_007466868
UniProt: A0A340Y0N1
Position
Un
AA seq 562 aa AA seqDB search
MAVLFPHPEPAASVSYLPCLPLLIHSLHEYLQRSLQNTVLITPLPLLREHYGSLMTSQSL
ATFAWLTHRSFHKQLRYLLLQQVSTNRKSRQWSSSSVTESFARVIHGLKVGHLTDRVIQR
SKRMILDTLGVGFLGTSTEVFQKAREYSKIYSSNVSSTVWGQPDFRLPPTYAAFVNGVAV
HSMDFDDMWHPATHPSGAVLPVLMALSEALPPSPKCSGLDLLLAFNVGIEVQGRLMHFSK
EAKDIPKRFHPPSVVGTLGSAAAASKFLGLSMTECQEALAIAVSHAGAPMANAATQTKPL
HVGNAARHGLEAAFLAMLGLQGNKQVLDMESGFGAFYANYAPKILPDVDSHTWLLDQQDV
AFKLFPAHLATHWVADAAASVRKQLVRDRAILPTDHMERIVLRIPDVQYVNRPFPDSEHE
ARHSFQYVACAMLLDGAITVSSFRKHQVNRPRVRELLGKVELEHPQDNLPNFNTLYSEIS
VALKDGSIFTERSDTFYGHWRKPLSQKDLQEKFRANACRMLSCHTVERLIEIVENLEDLE
DCSVLTTLLKEPSPPEIVSKSL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgctgtttccccatccagaacctgcggcgtcggtctcttacctgccctgtcta
cccctcctcatccattctctacatgagtacctacagagatctttgcaaaacacagttctg
atcacacctcttcctctcttaagagagcactatggctccctgatgacgtcacagtcttta
gccaccttcgcctggctgactcacagaagttttcataagcagctcaggtatctactcctc
cagcaagtctccaccaacagaaagagcaggcagtggtcctcgagttctgtcacagaaagc
tttgccagagtgatccatggcttgaaagtgggacacctgacagatcgtgttatccagagg
agcaagaggatgattctggataccctgggtgttgggttcctgggaaccagtacagaagtg
ttccaaaaagccagggaatacagtaaaatctatagttccaacgtatccagcactgtttgg
ggccagccagacttcaggctaccacccacatatgctgctttcgttaacggtgtggctgtt
cactcaatggattttgatgacatgtggcaccctgccacccacccttctggagccgtcctt
cctgtcctcatggctttatcagaagccctgcctccaagtccaaagtgttctggccttgac
ctgctgctggctttcaacgttggtattgaagtgcaaggccgattaatgcatttctccaag
gaagccaaggacataccaaagagattccatcccccctcagtggtgggaactttgggtagt
gctgctgcagcgtctaagtttttggggctcagcatgacagagtgccaagaggccctggct
attgctgtttctcatgctggggcacccatggcgaatgccgccactcagaccaagcctctt
catgtcggcaatgccgccaggcatgggctagaagctgcttttctggcaatgctgggtctc
cagggaaacaaacaggtcttggacatggagtcagggtttggggccttctatgccaactat
gcccccaaaatccttccagacgtagattcacacacttggctgctggaccagcaggatgtg
gccttcaagcttttccctgcccatttggccacgcactgggtggcagacgcggctgcatct
gtgagaaaacagcttgtaagagacagagccatacttcccactgaccacatggagagaatt
gtgcttagaattccagatgtccagtatgtgaataggcccttcccagactcggagcatgag
gcccgacactccttccagtatgtggcctgcgccatgctgctagatggtgccatcactgtc
tcatcattccgcaaacaccaggtcaacaggccacgggttagagagttgcttggtaaggta
gagctggagcaccctcaggacaacctaccaaatttcaacaccctctacagcgagataagt
gttgccctcaaggatggatccatcttcacagagcgctctgataccttctacggtcactgg
aggaagcctctgagccagaaagacctacaggaaaagttcagagccaatgcctgcaggatg
ctgtcctgccacactgtagaaaggcttatagagatagtagaaaacctagaagacctggaa
gactgctctgtgttaaccacgcttctgaaagaaccgtctccaccagagatagtttcaaaa
tctctctag

DBGET integrated database retrieval system