KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074069Help
Entry
103074069         CDS       T03090                                 

Gene name
HSPA1L
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1 like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve03040  Spliceosome
lve04010  MAPK signaling pathway
lve04141  Protein processing in endoplasmic reticulum
lve04144  Endocytosis
lve04213  Longevity regulating pathway - multiple species
lve04612  Antigen processing and presentation
lve04915  Estrogen signaling pathway
lve05134  Legionellosis
lve05145  Toxoplasmosis
lve05162  Measles
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103074069 (HSPA1L)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103074069 (HSPA1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103074069 (HSPA1L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103074069 (HSPA1L)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103074069 (HSPA1L)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103074069 (HSPA1L)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103074069 (HSPA1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103074069 (HSPA1L)
  09172 Infectious disease: viral
   05162 Measles
    103074069 (HSPA1L)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103074069 (HSPA1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lve01009]
    103074069 (HSPA1L)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lve03041]
    103074069 (HSPA1L)
   03009 Ribosome biogenesis [BR:lve03009]
    103074069 (HSPA1L)
   03110 Chaperones and folding catalysts [BR:lve03110]
    103074069 (HSPA1L)
   04131 Membrane trafficking [BR:lve04131]
    103074069 (HSPA1L)
   03051 Proteasome [BR:lve03051]
    103074069 (HSPA1L)
   03029 Mitochondrial biogenesis [BR:lve03029]
    103074069 (HSPA1L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103074069 (HSPA1L)
Protein phosphatases and associated proteins [BR:lve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103074069 (HSPA1L)
Spliceosome [BR:lve03041]
 Complex B
  Other components
   Prp19 complex
    103074069 (HSPA1L)
 Complex C
   Prp19-CDC5 complex
    103074069 (HSPA1L)
Ribosome biogenesis [BR:lve03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103074069 (HSPA1L)
Chaperones and folding catalysts [BR:lve03110]
 Heat shock proteins
  HSP70 / DNAK
   103074069 (HSPA1L)
Membrane trafficking [BR:lve04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103074069 (HSPA1L)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103074069 (HSPA1L)
Proteasome [BR:lve03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103074069 (HSPA1L)
Mitochondrial biogenesis [BR:lve03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103074069 (HSPA1L)
Exosome [BR:lve04147]
 Exosomal proteins
  Proteins found in most exosomes
   103074069 (HSPA1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Pox_D5
Motif
Other DBs
NCBI-GeneID: 103074069
NCBI-ProteinID: XP_007459606
UniProt: A0A340XDS3
Position
Un
AA seq 634 aa AA seqDB search
MAAAKGTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVTVCYKGEKKASVVLT
KMKETAESFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL
DKAGQGEXHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEF
KRKHKKDISQNKRAVRQLHTACERAKRTLSSSTQANLEIDSLYEGFDFYTSITRARFEEL
CADLFGGTLEPVEKALRDAKMNKSKVHDIVLVGGSTHIPKVQRLLQDYFNGRDLNNSINP
DEAVAYGAAVXAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQT
QIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGI
LNVTAMDKSTGKANKITITNDKGRLSKEEIEHMVLDAEKYKAEDEVQREKIAAKTALESY
AFNMEGAVSDEGLQGKINESDKKKILSKCSEVLSWLEANQLAEKDEFDHKRKELEQVCNP
IITKPYQGGCTGPSCATGYTPGRAATGPTIEEVD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctaagggaacggccattggcatcgacctgggcaccacctactcctgcgtg
ggggtgttccagcacggcaaagtagagatcatcgccaacgatcagggcaaccgcaccacc
cccagctatgtggccttcacggacaccgagcggctcatcggcgacgcggccaagaaccag
gtagccatgaatccccagaacactgtctttgatgccaaacggctgatcggcaggaaattt
aatgatcctgtggtgcaatcagatatgaaactttggcctttccaagtaatcaatgaagga
ggcaagcccaaggtaacggtgtgctacaaaggggagaaaaaagcttctgtggtactgact
aagatgaaggagactgctgaatcttttttgggccacagtgtcaccaatgctgtgatcacc
gtgccagcgtacttcaatgactctcaacgccaggccaccaaggatgcaggtgtgattgca
ggtctcaatgtgctaagaattatcaatgaacccacagctgctgccattgcctatggctta
gataaagcagggcagggagagtgacatgtcctgatctttgatctgggtggaggcacattt
gatgtgtccatcctgaccatagatgatgggatttttgaggtaaaggccacagctggggac
acccacctgggtggagaggattttgacaacaggcttgtgagccactttgtggaagagttc
aagaggaaacataagaaggacatcagccagaacaagcgggcggtgaggcagctgcacacc
gcctgcgagagggccaagaggaccctgtcgtccagcacccaggccaacttggaaattgat
tccctttatgaaggctttgacttctacacatccatcaccagagcccggtttgaagagttg
tgtgcagacctgtttgggggcacactggagcctgtggaaaaggctcttcgggatgccaag
atgaataagtctaaagtccatgacattgttttagtagggggctccacccacatccctaag
gttcagaggctattgcaggactactttaatggtcgtgatctcaacaacagcatcaacccc
gatgaggcagttgcctatggggctgcagtataggcagccattttgatgggagacaagtct
gagaacgtgcaggacctgctgctgctggacgtggctcccctgtcgctggggctggagacg
gctgggggcgtgatgactgccctcatcaagcgcaactccaccatccccaccaagcagacg
cagatcttcaccacctattcggacaaccagcccggcgtgctgatccaggtgtacgagggc
gagagggccatgacgcgggacaacaacctgctggggcgcttcgagctgagcggcatccca
ccggcgcccaggggggtgccccagatcgaggtgaccttcgacatcgacgccaatggcatc
ctgaacgtcacggccatggacaagagcacgggcaaggccaacaagatcaccatcaccaac
gacaagggccggctgagcaaggaggagatcgagcacatggttctggatgctgagaaatat
aaagctgaggatgaggtccagagagagaaaattgctgcaaaaactgccttagaatcctat
gcttttaacatggagggtgctgtgagtgatgaaggtctacagggcaagattaatgagtct
gataagaagaaaatactgagtaaatgcagtgaggtcctttcatggctagaggccaatcaa
ctggctgagaaagatgagtttgatcataagagaaaggaattggagcaggtgtgtaaccca
atcatcacaaagccctaccagggaggatgcactgggccttcctgtgcaacagggtataca
cctggaagggctgccacaggccccacgattgaagaagtagattaa

DBGET integrated database retrieval system