KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076037Help
Entry
103076037         CDS       T03090                                 

Gene name
TYW3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lve03016]
    103076037 (TYW3)
Enzymes [BR:lve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     103076037 (TYW3)
Transfer RNA biogenesis [BR:lve03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    103076037 (TYW3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 UPF0176_N DFRP_C
Motif
Other DBs
NCBI-GeneID: 103076037
NCBI-ProteinID: XP_007445964
UniProt: A0A340WFL5
Position
Un
AA seq 262 aa AA seqDB search
MDRSAEFRRWKAQCLSKADLSRKGSVDEDVVELVQLLNGREQFFTTSSCSGRIILLDGGI
NGSEVQKQNCCWLLVTHKLCVKDDVIVALKKANGDAILKFEPLVLHVQCRQLQDAQILHS
VAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLTHKGKLMVTEEYINFLIKIANHKMEE
NKKRIERFYNCLQHALEKETISMTSYPKEKIKEKKNSSYTHKKKRNPEKACGKYITDENN
KELENDDRDDPGISVTLFPEDY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtagcgcagagttcagaagatggaaggcgcagtgtctgagcaaagcggacctc
agccggaaaggcagtgtggatgaggatgtggtagagcttgtgcagctcttaaatgggcga
gaacagtttttcaccaccagttcctgctctggccgcatcatcctcctagacgggggtata
aatggttctgaggttcagaaacaaaactgttgctggctactggttacacacaaactctgt
gtgaaagatgatgtgattgtagccctaaagaaagcgaatggtgatgccattttgaaattt
gaaccacttgttcttcatgtgcagtgtcgacagttgcaggatgcacagattctgcattca
gtggcaatagattctggtttcaggaactccggcataacagtgggaaagagaggaaagact
atgttggctgtccggagcacacatggcttagaagttccattaacccataaaggaaaactg
atggtgacagaggaatatatcaacttcctgataaagatagcaaatcataaaatggaggaa
aacaagaagagaattgaaaggttttacaactgcctacaacatgctttggaaaaagaaact
atttctatgacctcatatcccaaagagaaaatcaaagagaaaaagaactcatcatatact
cacaagaaaaaaagaaacccagaaaaagcatgtggcaaatatattactgacgaaaataat
aaagaacttgaaaatgatgatcgtgatgatccaggaatcagtgttactctcttccctgaa
gattactga

DBGET integrated database retrieval system