KEGG   Lipotes vexillifer (Yangtze River dolphin): 103077662Help
Entry
103077662         CDS       T03090                                 

Gene name
NKTR
Definition
(RefSeq) natural killer cell triggering receptor
  KO
K12740  NK-tumor recognition protein
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lve03110]
    103077662 (NKTR)
Chaperones and folding catalysts [BR:lve03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103077662 (NKTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103077662
NCBI-ProteinID: XP_007445750
UniProt: A0A340WFE5
Position
Un
AA seq 1465 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
TKDVFEKKRKKPTHSEVSDSSSNSSSSSESSSESEIEHERSRRRKHKRRPKVKHSKKRRK
EASSSEEPRNKHIISPKGHSERSDTNEKRCIDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPLVTVEPEPKIPDITPTVNDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSDGHHKKRRKEKKVKHKKKAKKQKHCRRHKQTKKRRIIVPSDIESLKSSTRRVKSSC
DRERRSRSSSLSSHHSSKRDWSKSDKDDQSSSTHSSRDSYRSKSHSQSYSRGSSRSRTPS
KSSSHSRSRSKSRSSSKSGHQRTASKSPRGTASQLNENKPVKTEPLRATVTQNENVLVQP
VVAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYGSANVKETG
SSSSYHKREKNSESDRSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSLATSHSRS
RSPSSRSHSRNKYSDHSRCSRSFSYSSVSSDDGRRAKRKFRSNGKKNNTSNKRRSSSSEK
TLRNKYVKGRDKSSCHRKYSESRSSLDYSSDSEQSSVRVTQSAQEKEKQVQMDMNNKQEK
NRGEEKSKPERECPHSKKRTFKESPSDHFRNGSKPKRKNYAGSKWDSESNSEQDVTKNSK
NNSRPSSDKEEGEATSDSESELGEIHIKAKPATKSSANTLLPDGNSAWKSSKQRSSTSDS
EGFYSNSENSRGKPHKHKHSSKEHLKREHTKKAKEKLKGKKDKNHKAPKRKQAFHWQPPL
EFGEEEEEEINEKQVTQEAKEKKQLSENSEAVKENIPQTEKPCEDGNLSGKHNPITVSSD
TDQPTKDGSKLSVSPAALNMEENVVSSPPNIQHVEESIPSGVEDLLQTDDNMEICTPDRS
SPAKAEGASPLGNSRLDTPDISIVLKQDMPTEHPEAELGKQESSMSESKTVGEVGKQDSS
SASLATAVESTVKREVAEKSQTSLMDNKWKPLQGVGNLAAPSATTSSAVEVKALTTVPEI
KPQGLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDGDSQSRSPSRS
RSKSETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSY
KSHRTSSRSRSRSSSYDPHSRSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCR
SYGSDSESDRSYSHHRSPSESSRYS
NT seq 4398 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcaggaccggccgcagtgtcacttcgacatcgagatcaaccgggagccggtt
ggtcgcattatgtttcagctcttttcagatatatgtccaaaaacttgcaaaaacttcctt
tgcctatgctcaggggagaaaggccttgggaaaacaactgggaagaagttatgttataaa
ggttctacattccatcgtgtggttaaaaactttatgattcagggtggggacttcagtgaa
ggtaatggaaaaggtggagaatcaatttatggtggatattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaatcgagggaaacataccaatggt
tcccagtttttcatcaccacaaaacctgctccacacctggatggggtgcatgttgtcttt
ggactagttatttccggttttgaagtaatcgaacaaattgaaaatctgaaaactgatgct
gcaagtagaccttacgcagatgtgcgagttattgactgtggggtgcttgccacgaagtca
acaaaagatgtttttgagaaaaaaaggaagaaaccaactcattcagaagtctcggattcc
tcttccaattcctcttcctcttcagaatcatcctcagaaagtgaaattgaacatgagaga
agcagaagaaggaaacataagaggaggccaaaagttaaacactctaaaaagagacgaaag
gaagcaagcagttcagaagagccaaggaataaacatataataagcccaaaaggtcactct
gagaggagtgataccaatgaaaaaaggtgtatcgattcaaatgctaaaagggaaaagcct
gtggtgcgcccagaagagattcctccagtgcctgagaaccgatttttactaagaagagat
atgcctcttgtcacagtggagcctgaaccgaagattcctgatattacacccactgtaaat
gatcagaaaccatctgtatcaaagtctggacggaagattaaaggaaggggcacaattcgc
tatcacacacctccaagatcaagatcctgttccgaatcagatgatgatgatagcagtgaa
actcctcctcactggaaagaagaaatgcagagattaagagcatatagaccgcctagtgga
gaaaaatggagtaaaggagataagttaagtgacccctgttcaagccgatgggatgaaaga
agcttgtcccagagatcccgatcgtggtcctataatggatattattcagatctaagtaca
gcaagacactctgatggtcaccataaaaaacgcagaaaagagaaaaaggttaagcataaa
aagaaagctaaaaagcagaaacattgcagaaggcacaaacagactaagaagagaaggatt
attgtaccatctgacatagaatccttaaaatcttccacccgaagagtgaaatcctcatgt
gatagagaaaggagatctcgttcttcctcgttgtcatctcatcactcatccaagagggac
tggtctaaatccgataaggatgaccagagctcttccacccattccagcagagactcatac
agatcaaagtctcactcacagtcttattctagaggaagctcgagatcaaggactccgtca
aaatcctcatcacattctcgaagtagatcaaagtccagatctagttctaagtcagggcac
caaagaacagcatcaaaatcaccaagaggaacagcctctcagttaaatgaaaataaacct
gttaaaacagaacctttaagagcaacagtgacacaaaatgaaaatgttttagtacaacca
gtggtggcagaaaatattcctgtaataccactgagtgacagcccccctccttcaaggtgg
aagcctggacagaagccctggaagccctcttatgaaagaatccaggaaatgaaagctaaa
acaacccatttgctgcccatccaaagcacttatggttcagcaaatgttaaagagactggt
agttcatcatcctaccataaaagagaaaaaaattcagaaagtgatcggagcgcttattca
aaatacagtgatagaagttcagaaagttcaccaaggtcaaggagtagatcttctaggagt
agatcttattccaggtcatacaccagatctcgaagtttagctacttcacattcaaggtct
aggtctccctcatctagatctcattcacgaaataaatacagtgaccactcacggtgtagt
agatcattttcatactcttctgttagcagtgatgatggaagacgagccaagagaaaattt
agatccaatgggaaaaaaaataacacctcaaataaaaggcgcagcagcagctctgaaaag
acacttcgtaataaatatgtcaaaggcagagacaagtcttcatgtcatagaaagtacagt
gaaagcaggtcatctttagattattcttcagacagtgaacagtcaagtgttcgggttaca
cagtcagcccaggaaaaagagaagcaagtccaaatggacatgaataataaacaagagaaa
aacagaggtgaagagaaatctaagcctgaacgggaatgccctcattcaaaaaaaagaact
ttcaaagaaagtccttctgatcactttagaaatggcagtaagcccaaaaggaagaattat
gctgggagtaaatgggactctgagtcaaattctgaacaagatgtaactaaaaacagtaaa
aataattccaggccatcttctgataaggaggaaggtgaagccacttcagattctgagtca
gagttgggtgaaattcacatcaaagccaaaccagcaactaagtcttcagcaaatacttta
ctgcctgatggtaatagtgcctggaaatcaagcaaacagcggtcatcaacctctgattct
gaggggttctattccaattcagaaaacagtagaggaaaaccacacaagcataaacacagc
tccaaggagcatcttaaaagggaacataccaaaaaagcaaaagagaaattgaaagggaaa
aaagataaaaaccacaaggctccaaaacgaaaacaagcatttcactggcagcctccacta
gaatttggtgaagaggaggaggaggagattaacgaaaagcaagttactcaggaagcaaaa
gagaaaaaacaactttctgaaaacagtgaagccgtaaaagaaaatattccccaaactgag
aagccctgtgaagatggcaatctttcaggtaaacataatccaataacggtttcatcagat
actgatcagcctactaaagatggtagtaaactcagtgtgtctcccgcagctttaaacatg
gaggaaaatgtggtcagttctcccccgaacattcagcatgttgaagagagcatcccgagc
ggagtggaggatctgcttcaaacagatgacaacatggagatttgcactcctgataggagt
tccccagcaaaggccgagggggcttcccctctaggaaattcaaggcttgacaccccggat
ataagcattgttctaaagcaggatatgccaacagagcatcctgaggcagagttgggaaaa
caggaaagcagcatgtcagaaagcaaaacggtgggtgaggtgggaaaacaggacagcagc
tctgccagcttggccactgctgtagaaagcactgtgaagagagaggtggctgagaaaagc
cagaccagccttatggataataaatggaagcccctgcaaggtgtggggaacctggcagca
ccgtctgctactacatcaagtgctgtggaagttaaggcactgactactgtgcctgaaatt
aaaccacaaggcttgagaatagaaattaaaagcaaaaataaagttcggcctgggtctctc
tttgatgaagtaagaaagacggcacgcttaaaccggaggccaagaaatcaggagagttcg
agtgatgagcagacccctagtcgggatggcgatagccagtccaggagtccaagtagatct
cgaagtaaatctgagaccaaatcaaggcacagaacaaggtctgtctcctacagtcactca
aggagtcgatcgagaagttccacatcatcttatcgatcaagaagctactccagaagtcgg
agcagagggtggtacagcagaggccgcacaagaagccggagcagttcctaccgcagttac
aaaagccataggacgtccagcaggagcagatccaggagcagctcgtacgatccccacagt
cggtccaggtcctacacttacgatagctactatagcaggagtcggagtcgaagtagaagc
cagaggagcgacagttatcaccgaggcagaagctacaataggcggtccaggagttgtaga
tcttatggctctgacagtgaaagtgaccgaagttactctcatcaccggagtcccagtgaa
agcagcagatatagttga

DBGET integrated database retrieval system