KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078992Help
Entry
103078992         CDS       T03090                                 

Gene name
WNK2
Definition
(RefSeq) WNK lysine deficient protein kinase 2
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103078992 (WNK2)
   01009 Protein phosphatases and associated proteins [BR:lve01009]
    103078992 (WNK2)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103078992 (WNK2)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: Other
  Wnk family
   103078992 (WNK2)
Protein phosphatases and associated proteins [BR:lve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103078992 (WNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103078992
NCBI-ProteinID: XP_007468223
UniProt: A0A340Y4Q3
Position
Un
AA seq 2234 aa AA seqDB search
MDDDGGRRDAPGALMEAGRGAGPAGMAEPAAVPRARAARPGPQRFLRRSVVDSDQEEPLG
LEGADSPGAQPPQPLQRRVQLLSKTRRLIAERARGRPAVPAPAAPAVPLGDLADPGPEPA
GTQEPGLDPAPSPAPAPEGGPREEEAAAAARKEDVGALEARPELGRARREEPEEEEDDED
DLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKE
EAEMLKGLQHPNIVRFYDFWESSARGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSW
CRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTP
EFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKV
HDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWVE
DPKKLKGKPKDNGAIEFTFDLERETPDDVAQEMIESGFFHESDVKIVAKSIRDRVALIQW
RRKRIWPALQPQEQRDPGSPDKARGPPTPLQVQVTYHSQAGPPELEEPEADQHLLTPALP
ASATSLASDSTFDSGQGSTVYSDSQSSQQSVVLGSLADGVQPPAQCVCSPPVSVSDGPVL
PHSLPSLGAYQQPAVPGLSVASIPPPTRPLLPQQPFPEPAMSFAPGLPPPSAPVPTGPGQ
PTPPAHQPPHLTQPVPLPQVLAPQPMGPLQPVAPNLPPYLAPTSQVVAPAQLKPLQMPPA
PLQPLAQVPPQMPPLPVVPPIAPLATVDSLPAALPDLPATSGPAVPPPSQYFSPAVILPS
LPLSATTAPLPTSPALPLQTVKLPHPAGAPLAVPCQTIVPNVAATATGIPLLAVAPQGVP
ALSIHPTVAQLPAQPVYPAAFPQMVPSDVPPSPLHAAQNVRAAPPHPAPPMLPQPHKPSV
ARLAEQAAPAASAGSQILLGHPPPYAVDVTTQVPTVPAPAAVLSPPLPEVLPPTAPELLP
QLPGSLAPTVMAAAQSLPVQTTALLPPANLPLPSGPGITGPCPAVQLTVELPPEEQASQD
KQPSLPQSCESYGGSDVTSGREMSDSCEGAFGGGKLEGKAARKHHRRSTRARSRQERASR
PRLTILNVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETF
IEQMKDVMDKAEDMLSEDTDVDRGSDPGVSPPHLSTCGLGSGEESRQPQANALVYQQNVL
HTGKRWFIICPVAEHPAAEAPESSPPLPLSSLQPDTSQDSVFSKDQLSSKEKPSFSASLQ
LLSQAGPRDPPGGAPSPLVPSSPPVTAVPQDMAPPAASPKPEPATGSAMQAGVPGTPQGL
ASEHKTPWLLVETHDAQLVAQAPGTGRGPCAPSLEAPSHSTGLGDPGSAREPSTRGEPPL
ALAPVSGAPGGAPQPTLGQPLPPLPSVVGAISLATPQLPSPPLAPTAPPQPPSALESDGE
GPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSALAGTPVEAGDRDFTPEPPRGDEPRTE
ASGGDLALLPQPALEKSETALGLDVTLEQATSLPVTESSLSSMLGCEGGQVASDSPVVSS
VPQDAPASAIPARLEPTAWTSRIPGETLAESMQSCPGTVIQRGLESHPQTHSTLISGSPQ
KWPGQQDGSSPAKTVGRFSVVSTQDEWTLASPSSLRYSAPPDVYLDEAPHSPDMKLAVRR
AQTASSIEVGMGEPMSSDSGDECPRRRPPMQKHTSLPGSGGGVASDFVKKATAFLHRSSR
AGSPGLETPSRMGVKVPTISVTSFHSQSSYISSDNDSEIEDADIRKELQSLREKHLKEIS
ELQSQQKQEIEALYRRLGKPLPPNLGLFHTAPPVGRRRKSSKSKLKAGKLLNPLVQQLKV
VASSTGHLSDCSRAPPAQDPAQAGAGPTAASDPCGKAVQTQQPCSVRASLTADICSGLAS
DGGGVHGPGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSST
SSLVPGPEPGPQPALHIQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGPTQLKPSLNQLK
QTQKLHDMEAMAGWPPASGEARAMNTSRTAVGMPCLAPAPSPLPTAVIPGAASAQPVPMP
GTALSCLPAPPYALPLGQYGSLIPAPVSWGPWAAQAGSWSLDEGPGLGATGTPALPTFLW
PPMVSMPCPRLRIT
NT seq 6705 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgatggcggccgccgagacgcccccggcgcactgatggaggccgggcgcggt
gcggggcccgcgggcatggcggagccggcggcggtgccgcgggcgcgggcggcgcggccc
gggccccagcgcttcctgcgacgcagcgtggtggattctgatcaggaggagccgctgggc
ctggagggggccgactcgccgggcgcgcagcccccgcagccgctgcagcgaagggtgcag
ctactcagcaagacgcgacgcctcatcgccgagcgcgcccgcggtcgcccggccgtcccc
gcgcctgccgcgcctgccgtgccgctgggcgaccttgccgaccccggccctgagcccgcg
ggcacgcaggagcctggcctggaccccgcgccctcgcccgcgcctgcccccgagggcggc
ccccgcgaggaggaggcggcggcggccgcgaggaaggaggacgtgggggctctcgaggcg
aggccagagctcgggcgcgcacgccgggaggagcccgaggaggaggaggacgacgaggac
gacctcaaggctgtggccacctccctggacggccgcttcctcaagttcgacattgagctt
ggccgcggctccttcaagaccgtctacaaggggctggacacggagacctgggtggaggta
gcctggtgcgagctgcaggaccggaagctcaccaaactggagaggcagcggtttaaggag
gaggctgagatgctgaagggcctgcagcaccccaacattgtgcgcttctatgacttctgg
gagtccagtgccagggggaagcggtgcatcgtgctggtgactgaactgatgacctcaggg
acgctgaagacgtacctgaagcggttcaaggtgatgaagcccaaggtcctacgcagctgg
tgccggcagatcctgaagggcctgctgttcctgcacaccaggacgccccccatcatccat
cgggacctcaagtgcgacaacatctttatcaccggacccacagggtctgtgaagattggc
gacttgggcctggccaccctcaagagagcatcctttgccaagagtgtgataggtaccccc
gagttcatggcgccagagatgtacgaggagcattatgatgagtctgtggatgtttacgcc
ttcgggatgtgtatgctggagatggccacctcggagtacccctactcggagtgccagaac
gctgcccagatctacaggaaggtcacctgtggcatcaagccggccagctttgagaaagtg
catgatcctgaaatcaaggagattattggggagtgtatctgcaaaaacaaggaggaaagg
tacgagatcaaggacctgctcagccacgccttcttcgcggaggacacaggtgtgagggtg
gagctggccgaggaggaccatggcaggaagtccaccatcgccctgcggctctgggttgag
gaccccaagaaactgaagggcaagcccaaagacaatggggccatagaattcacctttgac
ctggagagggagacgccggatgacgtggcgcaggaaatgattgagtcaggatttttccat
gagagcgatgtgaagattgtggccaagtccatccgtgaccgcgtggcactgatccagtgg
cggcggaagaggatctggccagcgctgcagccccaggagcagcgggaccccggcagccct
gacaaggccaggggcccacccacacccctgcaggtccaggtgacctaccactctcaggct
gggccgccagagctggaggagcccgaggccgaccagcacctcctcacccctgcgctgccg
gccagcgccacctccctggcctcggacagcacgtttgacagtggccagggctccacggtg
tattcggactcgcagagcagccagcagagcgttgtgctgggctcgctggcggatggagtg
cagccccccgcccagtgtgtgtgcagcccccctgtgagcgtgagtgacgggcctgtcctg
ccacatagcctgccctcactgggggcctaccagcagcctgccgtgcctggcctgtcggtg
gcctccatcccgccccccacccgccctctgctcccacagcagccttttccagagccggcc
atgagcttcgcccctgggctgccaccgcccagtgcccctgtgccgacaggcccaggccag
cccacaccccctgcccaccagcctcctcacctgacccagccggtacccctgccacaggtc
ctggccccacagcctatgggccctctccagccggtggcccccaacctgcctccatacctg
gctccaacctcccaggtggtggcccctgctcaactgaagcccctccagatgcctccggcg
cccctgcagccacttgctcaagtccctccacagatgcctccacttcctgttgtccccccc
atcgctccactggccacagtcgacagcctccctgcagcccttcctgacctgccagccacc
agtgggcccgccgtgcctcccccctctcagtatttctctccggctgtcatcttgccaagc
ctcccactcagtgccaccactgctcccctgcccacgtcaccggccctgcctctgcagaca
gtcaagctgccccaccctgcaggggcaccactggccgtgccatgccagaccattgtgcca
aacgtggcggccactgctactggcatccctttgctggctgtggctccacagggtgtgcct
gccctgtccattcaccccactgtggcccagctccctgcccagcctgtgtacccggcggcc
tttccgcagatggtgcccagcgacgtcccaccttctcccctccatgcagcgcagaatgtg
cgggctgcccctccccacccggcaccccccatgctgccacaaccccacaagccaagtgtt
gcccgccttgccgagcaggctgctccggccgccagtgctgggagtcagatcctgcttggt
cacccgcctccatatgccgtggacgtcaccacccaggtccccacagtgcccgcgcctgct
gccgttctctccccacctctgccagaagtgctgccgcctactgcccctgagctcctgcct
cagctccccggctccctggctcccacagtgatggcggctgctcagagcttgcctgtccag
accactgcgctcctgccacctgctaacctgccactgcccagcgggcctgggatcactggt
ccctgcccagccgttcagctgacagtggagctgcccccggaggagcaggcctcgcaggac
aagcagccaagcctccctcagagctgtgagagctatggaggttctgacgtcacttctgga
agagagatgagtgacagctgtgaaggtgcatttggtggggggaagctggaaggcaaggcc
gctcggaaacatcaccgcaggtccacgcgtgcacgctcccgccaggagagagccagccgg
ccccggctgaccatcctgaatgtgtgcaacacgggtgacaagatggtggagtgccagctg
gagacacacaaccacaagatggtgacgttcaagttcgacctggatggggatgcacctgac
gagattgctacctacatggtagagcacgacttcatcctgcaggctgagcgggagacattc
attgagcagatgaaggacgtcatggacaaggcagaggacatgctcagtgaggacacggat
gtggaccgtggctctgaccctggggtgagcccgccgcacctcagcacttgtggcctgggt
tctggggaggagagtcgccaaccccaagcgaatgccctggtgtatcagcaaaatgtcctt
cacactgggaagaggtggtttatcatctgtccagtggctgagcatccagcagcagaggcc
cccgaatcttcacccccacttcctctgagctccctgcagccagacaccagccaagattca
gtgttctctaaagaccagctgtcttcgaaggaaaagcccagcttctcggctagtctgcag
cttttgagccaagcaggccccagggaccctcctggtggtgcaccatcccctttggtgcca
tcatctcctcctgtgactgctgtgccccaagacatggccccaccagctgccagtcctaag
ccagagccagcaacagggagtgccatgcaggcaggggtcccagggacccctcaggggctg
gccagtgagcataagaccccctggctactagtggagactcatgatgcccagcttgttgca
caggcccctggcacaggccgagggccttgtgccccatctctggaggccccatcccactcc
acgggtctgggggatcctggctcagccagagagcccagcaccaggggggagcccccgttg
gctttggcccctgtgtctggtgcccctggcggggcccctcagcccaccctgggccagccc
cttcctccactcccctctgtggtgggggccatcagcctggccactccccaacttcccagc
cccccgctggcacctaccgcccccccccagccgccctcagccttggagtcagatggggaa
gggccacccccaagggtgggcttcgtggacagcaccatcaagagcctggatgagaagctg
cggactctgctctaccaggagcatgtgcccacctcctcagccttggccgggacccctgtg
gaggcaggtgaccgagacttcaccccggagcccccaagaggggacgaaccccgcacagag
gcctctgggggtgacctggccctgctgccccagcctgcgttggaaaagtcagaaacagcc
cttgggttagatgtcacgttggagcaggccacgtccttgccagtgacagaatcatctttg
agcagcatgctgggctgtgaaggaggacaggtggcctcagattcgcctgtagtatccagt
gtcccccaggatgcccctgcttctgccatccctgcacgtctggagcccacagcctggacc
agcaggatccctggggaaaccttggccgagtccatgcagagctgcccggggacagtgatt
cagcgtggcctggagagccacccccagacacacagcactctgatctcgggatcccctcag
aagtggccagggcagcaggatggcagctcgccagccaaaactgtgggccggttctcagtg
gtcagcacccaggatgagtggactctggcctcccccagtagcctgcggtactcagcccca
cctgacgtgtacctggacgaggccccccacagcccagacatgaagctggctgtgcggcgg
gcacagacggcctcctccatcgaggtcggcatgggcgagcccatgtccagtgactctggg
gacgagtgccctcgaaggaggccccccatgcagaagcacacctccctgcctggcagtggt
ggtggtgtggccagtgactttgtgaagaaggccactgccttcctgcataggtcctctcgg
gctggctccccaggcctggagacacccagcaggatgggcgtgaaggtccccaccatcagc
gtgacctccttccactcccagtcttcctacatcagcagtgacaatgactcagagatcgag
gatgctgatatcaggaaggagttgcagagtcttcgagagaagcatctgaaggagatctcg
gagctacagagtcagcagaagcaggagatcgaggccctgtaccgccgcctaggcaagcca
ctgccccccaacctgggtctcttccacacggcacctccagtcggccgccggaggaagtcc
agcaagagcaagttgaaggcggggaagttgctaaaccccctggtgcagcagctcaaggtc
gtggcctccagcacaggtcacttgtcagactgcagcagagcccctcctgctcaggaccct
gcccaagctggggcagggcccacagcagcttcagacccatgtgggaaggcagttcagacc
cagcagccttgctccgtgcgggcctccctgactgcagacatctgctccggcttggccagt
gatggaggcggagtgcatggcccaggctggacggtttaccacccaacgtctgagagagtg
acctataagtctagtagcaaacctcgcgctcgattcctcagtggacccgtgtctgtgtcc
atctggtctgccttgaagcgtctctgtctaggcaaagagcacagcagtcggtcctccacc
agcagcctggtcccgggccctgagccgggcccccaacctgccctgcacatccaggcgcag
gtgaacaacagcaacaacaagaaaggcaccttcacggacgacctgcacaagttggtggat
gagtggacaagcaagacggttgggcccacgcagctgaagccgtcactcaaccagctgaag
cagacgcagaagttgcatgacatggaggccatggcaggctggcccccggcctctggcgag
gcacgggctatgaacacgtctcgaacagcagtggggatgccatgtctggccccggcaccc
agccctctacccaccgcggtcattcctggagctgcctcagcccagcctgtgcccatgcca
ggtactgctctctcctgccttccagccccgccctacgcactgcctttgggccagtatgga
agcctgatcccagctccagtgtcctgggggccctgggcagcccaagcaggcagctggagc
ctcgatgaggggccaggcttgggtgcaacaggcacgccagcactccccacgttcttgtgg
ccacctatggtcagcatgccctgccccaggctgcggatcacatag

DBGET integrated database retrieval system