KEGG   Lipotes vexillifer (Yangtze River dolphin): 103079153Help
Entry
103079153         CDS       T03090                                 

Gene name
GMPPB
Definition
(RefSeq) GDP-mannose pyrophosphorylase B
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00051  Fructose and mannose metabolism
lve00520  Amino sugar and nucleotide sugar metabolism
lve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103079153 (GMPPB)
   00520 Amino sugar and nucleotide sugar metabolism
    103079153 (GMPPB)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     103079153 (GMPPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 103079153
NCBI-ProteinID: XP_007446277
UniProt: A0A340WA13
Position
Un
AA seq 360 aa AA seqDB search
MKALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVL
EKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAM
VQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSP
AVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQ
PEQLCSGPGIVGNVLVDPSARIGENCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHIRSH
SWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVLEPRIIM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactgattttggtgggtggctatgggacgcgcctgcggccgctgacgctaagc
atcccgaagccgctggtggacttctgcaataagcccatcttgctgcaccaagtggaggcg
ctggccgcggccggcgtggaccacgtgattctggctgtgagctatatgtctcaggtgctg
gagaaggaaatgaaggcgcaggagcaaaggctaggaatccgaatctctatgtcccatgaa
gaggagcctttaggaacagctgggcccctggcactggcccgtgacttgctctctgagact
gcagacccttttttcgtcctcaacagtgacgtgatctgtgatttcccctttcaagccatg
gtgcagttccaccggcaccatggccaggagggctcaattctggtgaccaaagtggaggaa
ccctctaagtacggtgtggtggtgtgtgaggcggacacaggccgcattcaccggttcgtg
gagaagccgcaggtgtttgtgtccaacaagatcaacgcaggcatgtacatcctgagccct
gcagtgctacggcgcatccagctgcagcccacatccattgagaaggagatcttccctgtc
atggccaaggaggggcagctctatgccatggagttgcagggcttctggatggacattggg
cagcccaaggatttcctcaccggcatgtgcctcttcctgcagtcgctacgacagaagcag
cctgagcaactgtgctcaggccctggcattgtgggcaacgtgctggtggacccaagtgcc
cgtattggcgagaactgcagcattggccccaacgtgagtttgggtcctggtgtggtggtg
gaggatggtgtgtgcattcggcggtgcacggtgctgcgagatgcccacattcgctcccac
tcctggcttgagtcctgcattgtaggctggcgctgccgcgtgggccagtgggtgcgcatg
gagaacgtgacagtgctgggtgaggacgtcatagttaacgacgagctctacctcaacggg
gctagtgtgctgccccacaagtctattggtgagtcggtgctggagccccgcatcatcatg
tga

DBGET integrated database retrieval system