KEGG   Lipotes vexillifer (Yangtze River dolphin): 103079445Help
Entry
103079445         CDS       T03090                                 

Gene name
HOXA9
Definition
(RefSeq) homeobox A9
  KO
K21950  homeobox protein Hox-A9
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    103079445 (HOXA9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103079445 (HOXA9)
Transcription factors [BR:lve03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    103079445 (HOXA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hox9_act Homeodomain HTH_23
Motif
Other DBs
NCBI-GeneID: 103079445
NCBI-ProteinID: XP_007466143
UniProt: A0A340XYB7
Position
Un
AA seq 273 aa AA seqDB search
MATTGALGNYYVDSFXXXGTDAADELGAGRYAPGVLGQPPRQAAALAEHPDFSPCSFQSK
AAVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGAL
SFAGLPSSRPYGIKXXPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENN
PENESGGDKPPIDPSNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEV
ARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccggggccctaggcaactactacgtggactcattccnnnnnnnnggcacc
gatgccgcggatgagctgggcgcgggccgctacgcgccgggagtcctgggccagcccccc
cggcaggccgcggcgctggcggagcaccccgatttcagcccgtgcagcttccagtccaag
gcggcggtgtttggcgcctcgtggaacccggtgcacgcggcgggcgccaatgcggtgccc
gcggcagtgtatcaccatcatcaccaccacccctacgtgcacccccaggcgcccgtggcg
gcggcggcgccggacggcaggtacatgcgctcctggctggagcccacgcccggcgcgctc
tccttcgcgggcttgccctccagccggccctatggcattaaannnnnnccgctgtcggcc
agaaggggtgactgtcccacgcttgacactcacactttgtccctgactgactatgcttgt
ggttctcctccagttgatagagaaaaacagcccagcgaaggcgccttctctgaaaacaat
cctgagaatgagagcggcggagacaagccccccatcgatcctagtaacccggctgccaac
tggctccatgctcgctccacacggaagaagcgctgcccctatacaaaacaccagacgctg
gaactggagaaagaatttctgttcaacatgtatctcaccagggaccgcaggtacgaggtg
gcccgactgctcaacctcaccgagaggcaggtcaagatctggttccagaaccgcaggatg
aaaatgaagaaaatcaacaaggaccgagcaaaagacgagtga

DBGET integrated database retrieval system