KEGG   Lipotes vexillifer (Yangtze River dolphin): 103080077Help
Entry
103080077         CDS       T03090                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4-like
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lve03110]
    103080077
Enzymes [BR:lve01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103080077
Chaperones and folding catalysts [BR:lve03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    103080077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 103080077
NCBI-ProteinID: XP_007467526
UniProt: A0A340Y1K2
Position
Un
AA seq 131 aa AA seqDB search
MPPKGKSVSGKGSKGKAASGSDSSDKKAQGPKGGGNAVKVRHILCEKHGKILEAMEKLKS
GMKFNEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPISVLDKPVFTDPPVKTKF
GYHIIMIEGRK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaggaaaaagcgtatctgggaaaggctctaaaggaaaagcagcctctggg
agtgatagttctgacaagaaggctcagggtcccaaaggtggtggcaatgcagtaaaggtc
agacacattctgtgtgaaaaacatggaaaaatcttggaagccatggaaaagttaaagtct
ggaatgaaattcaatgaagtggccacacaatatagtgaagataaagccaggcaagggggc
gacttgggttggatgaccagagggtccatggtgggaccatttcaagaagcagcatttgcc
ttgcctataagtgtgctggataagcctgtgtttacagatcctccagttaagacaaaattc
gggtatcatattataatgattgaagggagaaaataa

DBGET integrated database retrieval system