KEGG   Lipotes vexillifer (Yangtze River dolphin): 103080634Help
Entry
103080634         CDS       T03090                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00350  Tyrosine metabolism
lve00360  Phenylalanine metabolism
lve00380  Tryptophan metabolism
lve01100  Metabolic pathways
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05034  Alcoholism
Module
lve_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
lve_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103080634 (DDC)
   00360 Phenylalanine metabolism
    103080634 (DDC)
   00380 Tryptophan metabolism
    103080634 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    103080634 (DDC)
   04726 Serotonergic synapse
    103080634 (DDC)
  09158 Development and regeneration
   04361 Axon regeneration
    103080634 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    103080634 (DDC)
   05031 Amphetamine addiction
    103080634 (DDC)
   05034 Alcoholism
    103080634 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103080634 (DDC)
Enzymes [BR:lve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103080634 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     103080634 (DDC)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103080634 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 103080634
NCBI-ProteinID: XP_007448397
UniProt: A0A340WL95
Position
Un
AA seq 315 aa AA seqDB search
MNAHEFRRRGKEMVDYVADYLEGIEGRQVYPDVEPGYLRPLLPTAAPQEPETFEDIIKDV
EKIIMPGVTHWHSPFFFAYFPTASSYPALLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLQLPAVFLAGEAGEGGGVIQGSASEATLVTLLAARTKVTRCLQAASPGLTQATIM
EKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAEGLIPFFVV
ATLGTTSCCSFDNLLEVGPICREEDVWLHVDAAYAGSAFICPEFRHLLNGVEYADSFNFN
PHKWLLVNFDCSAMW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacatgagttccgcaggagagggaaggagatggtggattacgtggctgactac
ttggagggcatcgaggggcgccaggtgtaccccgatgtggaacctggctacctgcgcccc
ctgctccccactgctgccccccaggagccagaaacatttgaggacatcattaaggatgtc
gagaagatcatcatgccaggggtgacccactggcacagcccgttcttctttgcctacttc
cccacggccagctcgtacccggccctgctcgcggacatgctgtgtggggctatcggctgc
atcggcttctcctgggctgccagtccagcgtgcacagagctggaaacagtgatgatggac
tggctggggaagatgctgcagctgcctgcggtgttcttggctggagaagctggagaaggg
ggcggagtgatccagggaagtgccagtgaagccaccctggtgaccctactggctgctcgg
accaaagtgacacgatgcctgcaggctgcctccccggggctgacacaggccaccatcatg
gagaagctggtggcctacgcatctgaccaggcacactcctccgtggaaagagctggcttg
attggtggagtgaaattaaaagcgatcccttccgatggcaagtttgccatgcgagcttcc
gccctgcaggaggccctggagagagacaaggccgagggcctgattccattcttcgtggtg
gccacgctggggaccacgtcctgctgctcttttgacaacctcttagaagtgggtcccatc
tgtcgcgaggaggacgtgtggctgcatgtggacgctgcctacgcgggcagcgccttcatc
tgccccgagttccggcatcttctgaatggagtggagtatgcagattcgtttaactttaat
ccccacaaatggcttttggtgaattttgactgctctgccatgtggtaa

DBGET integrated database retrieval system