KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082873Help
Entry
103082873         CDS       T03090                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04080  Neuroactive ligand-receptor interaction
lve04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103082873 (OXTR)
   04024 cAMP signaling pathway
    103082873 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103082873 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103082873 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lve04030]
    103082873 (OXTR)
G protein-coupled receptors [BR:lve04030]
 Rhodopsin family
  Peptide
   Oxytocin
    103082873 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 103082873
NCBI-ProteinID: XP_007463775
UniProt: A0A340XX50
Position
Un
AA seq 391 aa AA seqDB search
MEGALAANWSAEAVSGSAAPPGAQGNLTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTARRPRSRLLFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRVLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLITFKIWQNLRLKTAAAVA
EAAAGPEGAAADCAGRGALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWS
VWDAEAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSSSCLKGRRPR
ETSVSKKSNSSTFVLSPDSSSQRGCSQPSTV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgcgcttgccgccaactggagcgccgaggctgtcagcgggagcgcggcgccc
ccgggggcccagggcaacctcaccgctgggccgccacagcgcaacgaggccctggcgcgg
gtggaggtggccgtgctgtgcctcatcctcttcctggcgctgagcggcaacgcgtgcgtg
ctgctggcgctgcgcaccgcgcgccgcccgcgctcgcgcctcctcttcttcatgaagcac
ctgagcatagccgacctggtggtggcggtgttccaggtgctgccgcagctgctgtgggac
atcaccttccgcttctacggacccgacctgctatgccgcctcgtcaagtacctgcaggtg
gtgggcatgttcgcctccacctacctcctgctgctcatgtcgctcgaccgctgcctggcc
atctgccagccgctgcgcgtgctgcgccgccgcaccgaccgtctggccgtgctcgccaca
tggctgggctgcctggtggccagcgcgccgcaggtgcacatcttctcgctgcgcgaggtg
gccgatggcgtcttcgactgctgggccgtcttcatccagccctgggggcccaaggcctac
atcacgtggatcacgctcgccgtctacatcgtgcccgtcatcgtgcttgccgcctgctac
ggcctcatcaccttcaagatctggcagaacttgcggctcaagacggcggcggcggtggcc
gaggcggccgcgggacccgagggcgcggcggcggactgtgcggggcgcggggctttggcc
cgcgtcagcagcgtcaagctcatctccaaggccaagatccgcacggtcaaaatgaccttc
atcatcgtgctggccttcatcgtgtgctggactccattctttttcgtgcagatgtggagc
gtctgggacgccgaggcgcccaaggaagcctcggctttcatcattgccatgctgctggcc
agcctcaacagctgctgcaacccctggatctatatgctcttcacgggccacctcttccac
gagctcgtgcagcgcttcctctgctgctcgtccagctgcctgaagggccgccggcccagg
gagacgagcgtcagcaaaaagagcaactcgtcgacctttgtcctgagcccggacagctcc
agccagaggggctgctcgcagccatccacggtgtga

DBGET integrated database retrieval system