KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085290Help
Entry
103085290         CDS       T03090                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00561  Glycerolipid metabolism
lve01100  Metabolic pathways
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04923  Regulation of lipolysis in adipocytes
Module
lve_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103085290 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103085290 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    103085290 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    103085290 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lve01002]
    103085290 (MGLL)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103085290 (MGLL)
Peptidases [BR:lve01002]
 Serine Peptidases
  Family S33
   103085290 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Peptidase_S9 Abhydrolase_5 LIDHydrolase Abhydrolase_3 Abhydrolase_2 Thioesterase DUF1057 PGAP1 BAAT_C DUF1350
Motif
Other DBs
NCBI-GeneID: 103085290
NCBI-ProteinID: XP_007465326
Position
Un
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPSGTPRALVFVSHGAGEHCGRYDE
LARMLVGLELLVFAHDHVGHGQSEGERMVVSDFQVFIRDVLQHVDVVQKDHPGLPIFLLG
HSMGGAITILTAAQRPGHFSGMVLISPLVLANPESATTFKVLAVKVLNLVLPNVSLGRID
SSTLSRNKTEVDIYDTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAAAGTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggaaagttcccccaggcggaccccacagagcgttccgtaccaggacctccct
cacctggtcaacgccgacggacagtacctcttctgccggtactggaaaccctcgggcaca
cccagggccctggtctttgtgtcccacggagccggggagcactgtggccgctacgacgag
ctggctcggatgctggtggggctggagctgctggtgttcgcccacgaccatgttggccac
gggcagagcgagggggagaggatggtggtgtctgacttccaggttttcatcagggacgtg
ttgcagcacgtggacgttgtgcagaaggaccacccggggcttcccatcttcctcctgggc
cactccatgggaggtgccatcaccatcctcacggccgcacagaggcccggccacttctct
ggcatggttctgatctccccgctggttcttgccaatcccgagtctgccacgactttcaag
gtccttgctgtgaaagtcctcaaccttgtcctgccgaacgtgtccctgggccggatcgac
agcagcacgctctcacggaataagacggaggtggacatctacgacacggaccccctcatc
tgccgggcaggcctgaaagtgtgcttcggcatccagctgctcaacgccgtctcgagggtg
gagcgggcgctgcccaagctgaccttgcccttcctgctgctgcagggctctgccgaccgc
ctgtgtgacagcaggggcgcctacctgctcatggagtccgccaagagccaggacaagacg
ctcaagatttacgaaggtgcctaccacatcctccacaaagagcttcctgaagtgaccagc
tccgtcttccgtgagataaacacgtgggtctctcaaaggacagcggcggcaggaacgggg
tccccgccctga

DBGET integrated database retrieval system