KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085622Help
Entry
103085622         CDS       T03090                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04072  Phospholipase D signaling pathway
lve04150  mTOR signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04152  AMPK signaling pathway
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04520  Adherens junction
lve04910  Insulin signaling pathway
lve04913  Ovarian steroidogenesis
lve04923  Regulation of lipolysis in adipocytes
lve04930  Type II diabetes mellitus
lve04931  Insulin resistance
lve04932  Non-alcoholic fatty liver disease (NAFLD)
lve04960  Aldosterone-regulated sodium reabsorption
Module
lve_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103085622 (INSR)
   04015 Rap1 signaling pathway
    103085622 (INSR)
   04010 MAPK signaling pathway
    103085622 (INSR)
   04066 HIF-1 signaling pathway
    103085622 (INSR)
   04068 FoxO signaling pathway
    103085622 (INSR)
   04072 Phospholipase D signaling pathway
    103085622 (INSR)
   04022 cGMP - PKG signaling pathway
    103085622 (INSR)
   04151 PI3K-Akt signaling pathway
    103085622 (INSR)
   04152 AMPK signaling pathway
    103085622 (INSR)
   04150 mTOR signaling pathway
    103085622 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103085622 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103085622 (INSR)
   04923 Regulation of lipolysis in adipocyte
    103085622 (INSR)
   04913 Ovarian Steroidogenesis
    103085622 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103085622 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103085622 (INSR)
   04213 Longevity regulating pathway - multiple species
    103085622 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103085622 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103085622 (INSR)
   04931 Insulin resistance
    103085622 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103085622 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:lve04090]
    103085622 (INSR)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103085622 (INSR)
Protein kinases [BR:lve01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103085622 (INSR)
CD molecules [BR:lve04090]
 Proteins
  103085622 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 103085622
NCBI-ProteinID: XP_007460648
Position
Un
AA seq 1382 aa AA seqDB search
MGAGGGRGAAAVPLLVAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGAAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFFLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPMRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQEEDGELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDTRPSRKRRALGDVGNVTAAVPTIPAF
PNTSSTSAPTSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCV
SRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGFLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDELHPSFPEVSFFHSEENKVPESEELEME
FEDMESVPLDRSSHAQREEAGGRDGGSALGLKRNYQEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggcgggcggggggcggcggccgtgccactgctggtggccgtcgccgcg
ctgctggtgggcgccgcgggccacctgtaccctggagaggtgtgccccggcatggatatc
cggaataacctcacccggctgcacgagctggccaactgctcggtcatcgaaggacatttg
cagatcctattgatgttcaaaacgagacctgaggacttccgagacctcagtttccccaag
ctcatcatgatcactgattacttgctgctcttccgggtctacgggctggagagcctgaag
gacctgttccccaacctcacggtcatccggggctcccgcctcttctttaactacgcgctg
gtcatcttcgagatggttcacctgaaggagcttggcctctacaacttgatgaacattacc
cggggctccgttcgcatcgagaagaacaatgaactctgctacctggccactatcgactgg
tctcgcatcctggattccgtggaggataattacatcgtgctgaacaaagacgacaatgag
gagtgtggggacatttgtccaggcgctgcgaagggcaagaccaactgccctgccaccgtc
atcaacgggcaatttgtggagcggtgttggacgcacagccactgccagaaagtgtgtccg
accatctgtaagtctcacggctgcaccgctgagggtctctgttgccacagtgagtgcttg
ggcaactgctctgagcctgacgaccccaccaagtgtgtggcctgtcgcaactttttcctg
gatggcaggtgcgtggagacctgcccgcccccctactaccacttccaagactggcgctgt
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactctcggaggcagggc
tgccaccagtatgtcattcacaataacaagtgcatccctgagtgcccctccgggtacacg
atgaattccagcaacttgatgtgcactccatgcctgggcccctgtcccaaggtgtgccac
ctgctggaaggcgagaagaccattgactcagtgacatctgcccaggagctccgaggctgc
accatcatcaacggaagcttaatcatcaacattcgagggggcaacaacctggcagctgag
ctagaggccaaccttggactcattgaagaaatttcagggtatctgaaaatccgccgatca
tatgccctcgtgtcactttccttcttccggaagttacgtctgattcgaggggagaccttg
gaaatcgggaactactctttctatgccttggacaaccagaacctaaggcagctgtgggac
tggagcaaacacaacctcaccatcactcaggggaaacttttcttccactataatcccaaa
ctctgcttgtcagaaattcacaagatggaggaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcgtcctgtgaaaatgaattactt
aaattttcttacattcggacgtcttatgacaagatcttgctgaaatgggagccatattgg
ccccccgacttccgagaccttctggggtttatgcttttctacaaagaggccccttatcag
aacgtgacggagtttgatgggcaggatgcatgtggctccaacagctggaccgtggtggat
attgacccacctatgaggtccaacgaccccaagtcacagaaccaccccgggtggctaatg
cgtggtctcaagccctggacccagtacgccatctttgtcaagaccttggtcaccttttct
gatgaacgccgcacatacggggccaagagcgacatcatctatgtccagacagatgccact
aatccttctgtccccctggatcccatctcggtgtctaattcttcgtcccagattattctg
aagtggaagcctccctctgaccccaatggcaacatcacacactacttggtattctgggag
agacaggaggaagacggtgaactgtatgaattagattattgcctcaaagggttgaagctg
ccctcccggacctggtctccaccgttcgagtctgaggggtcccagaagcacaatcagagt
gagtacgaagagtctgccggtgaatgctgttcctgcccgaagaccgactctcagatcctc
aaggagttggaggagtcctcattcaggaaaacattcgaagattacctgcacaatgtcgtt
ttcatccccagaaaatcctcttcaggccctgttgccgaggacactaggccgtcgaggaaa
cgcagggcccttggtgatgtggggaatgtgacagcggccgtgcccaccattccggcattc
cccaatacgtcctcaaccagcgcacctacgagctcagaggagcacagaccattcgagaaa
gtggtgaacaaggagtctctggtcatctctggcctgcgtcactttactggctatcgcatt
gagctgcaggcttgcaaccaagattcccccgaggagaggtgcagtgtggctgcatatgtc
agtgccaggaccatgcccgaagccaaggcagatgatattgttggccccgtgacccacgaa
atcttcgagaacaacgtcgttcacttgatgtggcaggagcccaaggaacccaacggtctg
attgtgctgtacgaagtgagttatcgacgatacggcgaagaggagctgcacctctgcgtc
tcccgcaggcattttgctctggagcggggctgcaggctgcgtggtctgccacccgggaat
tacagtgtgcgagttcgggccacctccctggcgggcaatggctcctggacggaagccacc
tatttctacgtcacagactatttagacgtgccatcaaatattgcaaaaattatcatcggc
cctctcatctttgtctttctcttcagtgtcgtgatcggaagtatttatctgttcctgaga
aagaggcagccggatgggccactgggaccactgtatgcttcttcaaaccccgagtacctc
agtgccagcgatgtgtttccctgctctgtgtacgtgccggatgagtgggaggtgcctcga
gagaagatcacgctcctgcgagaactggggcagggctccttcggcatggtgtacgagggc
aacgccagggacattgtcaagggcgaggcggagacccgagtggcggtgaagacggtcaac
gagtctgccagcctgcgagagcggatcgaatttctcaacgaggcctcggtcatgaagggc
ttcacctgccaccatgtggtccgcctcctgggggtggtatccaaaggccagccgacgctg
gtggtgatggagttgatggctcatggggacttgaagagctacctccgttccctgcggcct
gaggccgagaataaccccggccgccctccccctaccctgcaagagatgattcagatggct
gcggagatcgccgacgggatggcatacctgaacgccaagaagtttgtacaccgggacctc
gcagctcgaaactgcatggttgcccacgattttaccgtcaaaattggagactttggaatg
accagagacatctacgaaacggattactaccggaaagggggaaagggtctgctccccgtg
cggtggatggcacccgaatcgctgaaggacggggtctttaccacttcttcggacatgtgg
tcctttggcgtggtcctttgggaaattaccagcttggcagaacagccttaccaaggccta
tcaaatgagcaggtgttaaaatttgtcatggatggagggtttctggatcaacccgacaac
tgtcctgagagagtcaccgacctgatgcgcatgtgctggcagttcaaccccaagatgcgg
ccgaccttcctggaaattgtcgacctgctcaaggacgagctgcacccaagttttcccgaa
gtttccttcttccacagcgaggagaacaaggtgcccgagagcgaggagctggagatggaa
tttgaggacatggagagtgtccccctggaccggtcctcacatgcgcagagggaggaggcc
gggggccgggatggagggtccgcactggggctaaagagaaactatcaggaacacatcccc
tacacccacatgaacgggggcaagaaaaacggacgcattctgactctgccccggtctaat
ccttcctaa

DBGET integrated database retrieval system