KEGG   Lipotes vexillifer (Yangtze River dolphin): 103086335Help
Entry
103086335         CDS       T03090                                 

Gene name
HLCS
Definition
(RefSeq) holocarboxylase synthetase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00780  Biotin metabolism
lve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    103086335 (HLCS)
Enzymes [BR:lve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     103086335 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     103086335 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     103086335 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     103086335 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_N BPL_C
Motif
Other DBs
NCBI-GeneID: 103086335
NCBI-ProteinID: XP_007470568
UniProt: A0A340YBY4
Position
Un
AA seq 870 aa AA seqDB search
MLITLCYLYLWARWGRGPAALVRTTVQQLRASRCSFTFCRAAAQPQGARVCLSHGGRVFC
VGESQVGGRARAPGGAEGGAGRGGGAASGSARYRKRPRDPALRPGRCSPGAPSAPPGACR
PGDPYQLIAKASVNDFSKLGVAFLEDRLQVANGLIPQKIVSVHLHDSALKELKDQASDTP
AQLLQPQPESSVESKPELEAMEHVGRKDRQVLGSTPTQGQGDTLGGEPAGESDRGVGSVE
HCHLHLSSCHECLELENSTIESVKFASAENIPDLPYDYSSGLEGIAYDLCPKRKQRRVNL
TGKAPNILLYVGSDSQDALGRLQQVRSALADCVDTSCYTLYHLPLESALRDPWPDNCLLV
VIATRESVPEDLSRRFMAYLAQGGKVLGLSSPFTLAGFQVTRKAALQDTVQSLVFCKADW
SQVRLSVLSSGCIYEGGPGEPLSLGKLQGHLDNKDEDRLIVQVPFGTRGGEAVLCQVHLE
LPPSSPVVQTQEDFNLLKSSNFRRYEVLKEILTTLGLSCDAKHVPALTPLYLLSAAEEIR
DPLMQWLGKHVDAEGVIKSSKLSLKFVSSYTSEIEITPSAIPVVTDIEAFSSENFNFEIY
RQNLQTKKLGKVILFAEVTPTTMSLLDGLMFEMPQEMGLIAIAVHQTQGKGRGRNAWLSP
VGCALSTLLVSIPLRSQLGQRIPFVQHLMSLAVVEAVRSIPGYQDINLRVKWPNDIYYSD
LMKLGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLITEYNKQHGAELKPLRADYL
IARSVTVLEKLIDTFQDEGPNGVLPLYYKYWLHSAQQVRLGSAEGPKVWIVGLDDSGFLL
VHQENGEVVTVHPDGNSFDMLGNLIIPKQP
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcacgctgtgctacttgtacctgtgggcgcgttgggggcgcgggcccgccgcg
ctagtgcgcaccacggtgcagcaactgcgggcctcgcgctgctccttcaccttctgccgc
gcggctgcgcagccccagggcgcccgcgtgtgcctgagccacggcggccgcgtcttctgc
gtcggcgagagccaggtgggcgggcgagcgcgggcgcccgggggcgcggaaggcggggcc
gggcggggcgggggcgcggcctcggggtctgcccggtaccggaagcgaccccgggacccc
gcgctccgccctgggcggtgcagcccgggggcaccctctgcgccgccgggagcttgcaga
cctggggatccttatcagttaatcgccaaagcaagtgtgaatgacttcagcaagctggga
gtggcgttccttgaagatagactccaggtggctaatggactgataccccaaaagatcgtt
tctgtccacttgcacgactctgctctgaaggaacttaaggatcaggcctcagacacgcca
gcgcagctcctacagccccagcctgaatcttctgttgagagcaagcctgagctggaggct
atggagcatgttggcagaaaggaccgccaggttctgggttccacacccacgcaggggcaa
ggcgatacccttgggggcgagcctgccggggagagcgacagaggcgtgggctccgtcgag
cactgtcacctccatctttctagctgccacgagtgtttggagcttgagaacagcaccatc
gaatccgtcaagtttgcctctgcagagaacattccagatcttccctacgactacagcagt
ggtttggagggtatcgcgtatgacctctgccccaagagaaaacagaggagggtcaacctc
acgggaaaagcacctaacatccttctctacgtggggtccgactcccaggacgccctgggc
cggctccagcaggtccggtcagctctggccgactgcgtggacaccagctgttacactctc
taccacctgccgctggaaagtgctctcagggacccatggccagacaactgcctgttggtg
gtcattgccacaagggagtccgtccctgaggacctgtcccggaggttcatggcctatctt
gctcagggagggaaggtactgggcctgtcatcgcccttcacgcttgctggcttccaggtg
accaggaaggccgcactgcaggacacagtccagagcttggttttctgcaaggcggactgg
agccaggtgaggctcagcgtcctgagcagcggctgcatttacgaggggggccccggggag
ccgctcagcctgggcaagctccagggccacctggacaacaaggacgaggacaggctgatt
gtgcaagtgcctttcggaacacgtggcggagaagctgttctttgtcaggtgcacctggaa
ctacctcccagctctccagtagtgcaaacacaagaggattttaacctgctcaaatcaagc
aattttagaagatacgaagtccttaaggagatcctgacgacgcttggcctaagctgtgac
gcaaaacatgttcctgccttaacgcctctttacttgctgtcggcagctgaggaaatccgg
gatcctcttatgcagtggctggggaaacatgtggatgctgaaggagtaataaaatctagc
aagctctcccttaaattcgtttcatcctacacatctgaaatagaaatcaccccatctgct
atacctgtggtgactgacatagaggccttctcatcagaaaattttaactttgagatctat
cgacaaaatttgcagacaaagaaacttggaaaagtaattctgtttgctgaagtgacacct
accacaatgagtcttctggacgggttgatgtttgagatgccacaggaaatgggtttaatc
gccatcgcagtccaccaaacgcagggcaaagggcggggaaggaatgcttggctgagcccc
gtgggatgcgctctctctaccctgcttgtctccatcccactgagatcccagctgggacag
aggattccgtttgtccagcatctgatgtctctggctgtcgtggaggcggtaaggtccatt
cctgggtaccaggatatcaacttacgagtgaagtggcccaacgatatttattacagtgac
ctcatgaagcttggtggagttctggttaactcaacacttatgggagaaacattttatata
cttattggctgtggatttaacgtgactaacagcaaccctaccatatgcatcaacgatctc
atcacagaatacaataagcaacacggggccgaactaaagcccttaagagctgattatctc
atcgccagaagtgtgactgtgctggagaagctgatcgacacatttcaggacgaagggccc
aatggcgttcttcctctctattataaatattggctacacagtgctcagcaagtccgcctg
ggaagtgctgagggaccaaaggtgtggatcgtcggcctagatgattccgggttccttctg
gttcaccaggaaaacggtgaagtggtgactgtgcatccagacggcaactccttcgacatg
ctgggaaacctcataatccccaaacagccgtag

DBGET integrated database retrieval system