KEGG   Lipotes vexillifer (Yangtze River dolphin): 103086362Help
Entry
103086362         CDS       T03090                                 

Gene name
ZDHHC16
Definition
(RefSeq) zinc finger DHHC-type containing 16
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103086362 (ZDHHC16)
Enzymes [BR:lve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103086362 (ZDHHC16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 103086362
NCBI-ProteinID: XP_007456268
UniProt: A0A340X3Z2
Position
Un
AA seq 377 aa AA seqDB search
MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFAGSDTA
VDAAFEPIYWLVDNVIRWCGVVFVVLVIVLTSSIVAIAYLCILPLILQTYSVPRLCWHFF
YSHWNLILIVFHYYQAITTPPGYPPPGRNDITAVSICKKCINPKPARTHHCSICNRCVLK
MDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKL
QAVANQTYHQTPPPTFSFQERVTHKSLVYLWFLCSSVALALGALTVWHAVLISRGETSIE
RHINKKERRRLQAKGRVFRNHYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMS
WDPPPWVTAHSASVMAV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcggggccagcggagcctgctgctgggccctgcccgcctctgcctgcgcctgcttctg
ctcctgggctacaggcgccgctgcccacctctgctccgcggcctggttcagcgctggcgc
tatggcaaggtctgcctgcgctccctgctctacaactcctttgcaggcagtgacaccgct
gtggatgctgcctttgagcctatctactggctggtggacaacgtgatccgctggtgtggg
gtggtgttcgtggtgctggtgattgtgctgaccagctccatcgtggccatcgcctacctg
tgtatcctgcccctcatccttcaaacctactcagtgccacgactctgctggcatttcttc
tatagtcactggaatctgatcctcatcgtcttccattactaccaggctatcaccactcca
cctggatacccacccccgggcaggaatgatatcacagcagtctccatctgtaagaagtgc
attaaccccaagccagcccgaacacaccactgcagcatctgcaataggtgtgtgctgaag
atggatcatcactgcccctggctaaacaactgtgtaggccactataaccatcggtacttc
ttctctttctgcttcttcatgactctgggctgtgtctactgcagctacggaagttgggac
cttttccgggaggcttacgctgccatcgagaaaatgaaacagctcgacaagaacaaacta
caggcggttgccaaccagacttatcaccagaccccaccacccaccttctccttccaagaa
agagtgactcacaagagtcttgtctacctctggttcctgtgcagttccgtggcacttgcc
ctgggtgccctaactgtatggcacgctgttctcatcagtcgaggtgagactagtatcgaa
aggcacatcaacaagaaggagcgacgccgactgcaggccaagggcagagtttttaggaat
cattacaactatggctgcttggacaactggaaggtattcctgggtgtggacacaggaagg
cattggctgactcgggtgttgttaccttccagtcacctgccccatgggaacggaatgagc
tgggatccccctccctgggtgaccgctcactcagcctctgtgatggcagtgtga

DBGET integrated database retrieval system