KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087069Help
Entry
103087069         CDS       T03090                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103087069 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103087069 (ASIC1)
Ion channels [BR:lve04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103087069 (ASIC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC EFP
Motif
Other DBs
NCBI-GeneID: 103087069
NCBI-ProteinID: XP_007452343
UniProt: A0A340WS54
Position
Un
AA seq 574 aa AA seqDB search
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGELLMAPVPFPCHGHGVTRYHPKHAAHLRPTRPPHLPAPGAFPCPSELCD
IGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRH
NPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgttgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcgctctgggccctctgcttcctgggctcgctggctgtgctgctgtgtgtg
tgcaccgagcgcgtgcagtactatttccactaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcaccttccccgcggtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtaccacgctggggagctgctggctctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatactgcaggac
aaggccaacttccgcagcttcaagcccaagcccttcaacatgcgcgagttctacgaccgt
gcggggcacgacattcgagacatgctgctctcctgccacttccggggggaggtctgcagc
gctgaggacttcaaggtggtcttcacacggtatggaaagtgctacactttcaactctggc
cgagatgggcgtcccaggctgaagaccatgaagggtgggacgggcaatgggctggagatc
atgctggacattcagcaggacgagtacctgcccgtgtggggggagaccgatgagacgtcc
ttcgaagcgggcatcaaagtgcagatccacagtcaggatgaacctcccttcattgaccag
ctgggctttggtgtagccccagggttccagacctttgtggcctgtcaagagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggacttggatttcttc
gactcctacagcattaccgcctgccgcatcgactgtgagacccgctacctggtggagaac
tgtaactgccgcatggtgcacatgccaggggatgccccatactgcactccagagcagtac
aaggagtgtgcagatcctgccctggacttcctggtggagaaggaccaggagtactgcgtg
tgtgaaatgccctgcaacttgactcgctatggcaaggagctgtccatggtcaagatcccc
agcaaagcgtcagccaagtacctggccaagaagttcaacaagtctgagcagtacataggg
gagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccattgagcag
aagaaggcctatgagattgcaggactcctgggtgagctgctgatggcacctgtccccttc
ccatgccatgggcatggtgtgacacgctaccacccgaagcacgctgctcacctccgtccc
acaaggcctcctcacctgccagccccaggggccttcccctgccccagtgagctctgtgac
attggaggccagatgggtctgttcattggggccagcatcctcactgtgctggagctcttc
gactacgcctacgaggtgataaaacacaagctgtgcaggcgagggaagtgccagaaggag
gccaaacggagcagcgcggacaagggcgtggccctcagcctggatgacgtcaaaagacac
aacccgtgtgagagcctccggggccatcctgccgggatgacgtatgctgccaacatccta
cctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system