KEGG   Lipotes vexillifer (Yangtze River dolphin): 103089088Help
Entry
103089088         CDS       T03090                                 

Gene name
PPIC
Definition
(RefSeq) peptidylprolyl isomerase C
  KO
K09563  peptidyl-prolyl isomerase C (cyclophilin C) [EC:5.2.1.8]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lve03110]
    103089088 (PPIC)
Enzymes [BR:lve01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103089088 (PPIC)
Chaperones and folding catalysts [BR:lve03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103089088 (PPIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103089088
NCBI-ProteinID: XP_007455315
UniProt: A0A340X8F3
Position
Un
AA seq 212 aa AA seqDB search
MGPGPRLLLPLVLCVGLSDLIPPAGASGVRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFG
KVVPKTVENFVALATGEKGYGYRGSKFHRVIKDFMIQGGDFTSGDGTGGISIYGETFPDE
NFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQA
TDGHDRPLTNCSIINSGKIDVKTPFVVEVADW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggtccccggctgctgctacctctggtgctttgcgtggggctcagcgatctc
atacctcctgcgggagcgtcaggcgtccgcaagcgaggcccgtcggtgacggccaaggtc
ttctttgatgtgaggattggagataaagatgttggcagaattgtgattggcctctttgga
aaagttgtgcccaagactgtggaaaattttgtcgctctggcaacaggagagaaaggatat
ggatacagaggaagcaaatttcatcgcgtcatcaaagatttcatgattcaaggaggggac
ttcaccagtggagatggcactggcggtataagcatttatggtgagacatttcccgatgag
aacttcaaactgaagcattatggcattgggtgggtcagcatggccaatgctgggcctgac
accaacggctctcagttctttatcaccttgaccaagcccacctggttggatggcaaacat
gtggtatttggaaaagtcattgatggaatgacagtggtccactccatagaactgcaggca
actgatgggcatgaccgtccactcaccaactgctccatcatcaacagtggcaagatagat
gtgaaaacgccctttgtggtagaggtcgctgactggtga

DBGET integrated database retrieval system