KEGG   Lipotes vexillifer (Yangtze River dolphin): 103089238Help
Entry
103089238         CDS       T03090                                 

Gene name
KCNK2
Definition
(RefSeq) potassium channel, subfamily K, member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04927  Cortisol synthesis and secretion
lve04934  Cushing syndrome
lve04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    103089238 (KCNK2)
  09154 Digestive system
   04971 Gastric acid secretion
    103089238 (KCNK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103089238 (KCNK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103089238 (KCNK2)
Ion channels [BR:lve04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   103089238 (KCNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 103089238
NCBI-ProteinID: XP_007451347
UniProt: A0A340WUR8
Position
Un
AA seq 422 aa AA seqDB search
MMNPQARRNFYLAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVETDTTINVMKWKTVST
IFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAA
INAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPL
FGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAII
FKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVL
SMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRK
LSAELAGNHNQELTPCRRTLSVNHLASERDVLPPLLKTESIYLNGLTPHCAGEEIAVIEN
IK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacccacaagcaagaaggaacttctacttggcggcccctgacttgctggatcct
aaatctgccgctcagaactctaaaccaaggctctcgttctccacgaaacccaccgtgctt
gcttcccgggtggagactgacacgaccattaatgttatgaaatggaagacggtctccacg
attttcctggtggtcgtcctctatctgatcatcggagccacagtgttcaaagcgttggag
cagcctcacgagatttcccagaggaccaccattgtgatccagaagcagacgttcatttcc
cagcactcctgtgtcaattcgactgagctggacgaactcatccagcaaatagtggcagca
ataaatgcagggattatacctttaggaaacacctccaatcaaatcagtcactgggatttg
ggaagttccttcttctttgccggcactgttattacaaccataggatttggaaacatctca
ccacgcacagaagggggaaaaatattctgtatcatctatgccttactgggaattcccctc
tttggttttctgttggctggagttggagatcaactaggaaccatatttggaaaaggaatt
gcaaaagtggaagatacatttattaagtggaatgttagtcaaaccaagattcgaatcatc
tcaacaatcatatttatactgtttggctgtgtactctttgttgctctgcctgcgatcata
ttcaagcacatagaaggctggagtgccctggacgccatttattttgtggttataacttta
acaaccattggctttggcgactacgttgcaggtggatcagatattgaatacctagacttc
tataagcctgtcgtatggttttggatccttgtagggcttgcttactttgctgctgtcctg
agcatgattggagactggctccgagtgatatcaaaaaagacaaaagaagaggtgggagag
tttagagcccatgccgctgagtggacagccaacgtcacggccgaattcaaggaaaccagg
aggcggctgagtgtggagatttacgacaagttccagcgtgccacctccataaagcggaag
ctctccgcagaactggctggaaaccacaaccaggagctgactccctgtaggaggaccctg
tcagtgaaccacctcgccagcgagagggatgtcttgcctcccttactgaaaactgaaagt
atctatttgaacggactgacgccacactgtgcgggcgaggaaattgctgttattgagaac
attaaatag

DBGET integrated database retrieval system