KEGG   Lipotes vexillifer (Yangtze River dolphin): 103089768Help
Entry
103089768         CDS       T03090                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00600  Sphingolipid metabolism
lve01100  Metabolic pathways
lve04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103089768 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103089768 (GALC)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     103089768 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 103089768
NCBI-ProteinID: XP_007471673
UniProt: A0A340YFI9
Position
Un
AA seq 650 aa AA seqDB search
MTHTMAEHLLQASRQRQVKAMTAAAGSAGQAAVLLLLCALLAPGGAYVLDDSDGLGREFD
GIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSH
MHYALDENYFRGYEWWLMKEAKKRNPNITLMGLPWSFPGWLGKGFNWPYVNLQLTAYYVV
SWIVGAKHYHDLDIDYIGIWNERAFDINYIKVLRRMLNYQGLQQVKIIASDNLWEPISAS
VLLDSELLKVIDVIGAHYPGTRTVKDARLTKKKLWSSEDFSTLNSDVGAGCWGRILNQNY
INGYMTATIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVEAPIWISAHTTQFTQPGWY
YLKTVGHLEKGGSYVALTDGLGNLTIIVETMSHKHSMCIRPLLPYFNVSRQFATFILKGS
FSEIPELQVWYTKLGKPSERFLFKQLDSLWLLDSGGSFTLELQEDELFTLTTLTTGSKGS
YLLPPKSQPFPCVYKDDFNVDYPFFSEAPNFADQTGVFEYFMNIEDPGEHRFTLRQVLNQ
RPITWAADAFNTISIIGDYKWSNLTIKCDVYLETPEKGGVFIAGRVNKGGILIRSARGVF
FWIFANGTYRVTGDLAGWIIYTSGHADVTAKKWYTLTLTINVSITDQNAR
NT seq 1951 nt NT seq  +upstreamnt  +downstreamnt
atgacccacacaatggctgagcacctactccaggcttcccggcaacgccaagtgaaagcc
atgacggccgccgcgggttcggcgggccaagccgcggtgctcctgctgctgtgcgcgctg
ctggcgcccggcggcgcgtacgtgctcgacgactccgacgggctgggccgggagttcgac
ggcatcggagctgtcagcggcggcggggcaacctcccgacttctagtaaattacccagag
ccctatcgttctcaaatactggattatctctttaagccgaacttcggtgcctctttgcat
attctaaaagttgaaataggtggtgatgggcagacaacagatggcactgagccctcccac
atgcactatgcattagatgagaattatttccgaggatatgagtggtggttaatgaaggaa
gctaagaagcggaaccctaatatcacactcatggggctgccatggtcgttccctggatgg
ctggggaaaggtttcaactggccctatgtaaatcttcagctgactgcctactatgtcgtg
agttggattgtgggcgccaagcattatcatgatctggacattgattatatcggaatttgg
aatgagagggcatttgacatcaattatatcaaggtgttaagaagaatgctgaactatcag
ggtctccagcaagtgaaaatcatagcgagtgataatctctgggagccaatttctgcttct
gtgctgcttgactctgagctcttgaaggtgattgatgttataggagctcattaccctggg
acccgtacagtaaaggatgctaggttgactaagaagaaactttggtcttctgaagatttt
agcactttaaatagtgatgtgggtgcaggctgctggggtcgcatattgaatcagaattat
atcaatggctacatgactgccacaattgcttggaatttggtggctagttactatgaacag
ttgccatatgggcgctgtggactgatgactgctcaggagccatggagcgggcactatgta
gtggaagctcctatctggatatcagctcataccactcagtttactcaaccaggttggtat
tacctgaagacagttggccatttagaaaaaggaggaagctatgtagctctgacggatggc
ttaggtaacctcaccatcatcgttgaaactatgagtcataaacattccatgtgtatacgg
ccacttcttccctatttcaatgtttcacgacaatttgctaccttcattcttaagggttct
tttagtgaaataccagagctgcaggtgtggtataccaaacttggaaaaccatcagagaga
tttcttttcaaacaactggattctctatggctcctagacagcggtggcagcttcacgctg
gaactgcaagaggacgagctgttcacactcaccacgctcaccaccggaagcaaaggcagt
tacctgctgcctccgaagtcccagccctttccctgtgtctataaggatgacttcaatgtc
gattacccattttttagtgaagctccgaattttgctgatcagactggtgtatttgaatac
tttatgaatattgaagaccctggagagcatcgcttcacactgcgccaggttctcaatcaa
aggcccattacttgggctgctgatgcattcaacaccatcagtattataggagattacaaa
tggtccaatttgactataaagtgtgatgtgtacctagagacccctgagaagggaggtgtg
ttcattgctggaagagtgaataaaggtggtattttgattagaagtgccaggggagttttc
ttctggatttttgcaaatggaacctacagagttacaggtgatctagctggatggatcata
tatacttcaggacatgctgacgttacagcaaaaaaatggtatacactcactttaactatt
aatgtaagtattactgatcagaatgcccgag

DBGET integrated database retrieval system