KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090497
Entry
103090497         CDS       T03090                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lve01009]
    103090497 (AKAP5)
Protein phosphatases and associated proteins [BR:lve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103090497 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 103090497
NCBI-ProteinID: XP_007460121
UniProt: A0A340XF64
Position
Un
AA seq 429 aa
MEITVPEIQVESKDEKRSAEVSPQNERQEEKASTLCFKRRKKAAKAMKPKAGSEAAADAA
RKCPPEAGASDQPEPPGGAWASIKRLVTRSKRSDSSKQQKPFEAKVQPEINAEDDNSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDCSIKVQRQAGSLDTKTLTQSDDQAAKTKPKQ
DVREDVSQKGSDEVCESNVNNSITSPGEKVISVELELDTGHSAIHTGTLILEKDIETLEE
KQSIQPQQASPLETSDTEHQLPVVSDVPPSPAVPDQQILEGARNSILESGPDWKDRESKE
TVAEESKPKDTELSQESDFQVNEITAEKPKTEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIENEQVGFFANDSGFDSRTSEQYETLLMETASSLVKNAIQLSIEQLVNEMASD
DNAESSLLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggagatcacagttcctgaaatacaagtagaaagtaaggatgagaagagatcagcagaa
gttagtcctcagaatgagaggcaggaggaaaaagcatcgacactttgcttcaagagaaga
aagaaagcagccaaagcaatgaagcccaaagctggctctgaagctgctgctgatgcagca
aggaagtgtcccccagaagcaggagcttctgatcagccagagccccccgggggggcctgg
gcctccatcaaacgccttgtaacacgcagcaaaaggtcagattcttcaaagcagcaaaag
ccctttgaggccaaagtgcaacctgaaatcaatgctgaggatgataattctaaaaaaaag
gcaaaatccagactcaagattccctgtataaaattctcaaaaggggagaaaagaagtaat
cattccaaaattatagaagactcagactgcagtatcaaagtccaacgacaggctggaagt
ttggatacaaaaactctgacccaatcagatgaccaggcagcaaagaccaagccaaagcag
gatgtaagggaagacgtctcacagaaagggagtgatgaggtctgtgaatcaaatgtgaac
aacagcataacttctcctggagagaaagtgatttcagtagaacttgagttagatacaggg
cattctgctattcatacaggaactctaatccttgaaaaagatattgaaacgcttgaggaa
aaacaaagcattcaacctcagcaagcaagcccactggaaacttcagacacagaacaccag
ctcccagtggtttctgatgttcctccctcacctgcagtcccagatcaacaaattctggaa
ggagccagaaacagtatcctagaaagtggaccagattggaaagaccgtgaaagtaaagag
actgttgctgaggagagtaagccgaaagatactgaactgagccaggagtcagattttcaa
gtaaatgaaatcactgcagaaaaacccaaaacagaagaaagcaaaagaatggagccaatt
gctattattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatttcaatcgaaaatgagcaagtggggttttttgctaatgatagt
ggttttgacagtagaacttcagaacaatatgaaacactcttaatggaaacagcttcttct
cttgtcaagaatgctatccagttatctatagaacagctggttaatgaaatggcctctgat
gataatgcagaaagcagtcttctacagtga

DBGET integrated database retrieval system