KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090681Help
Entry
103090681         CDS       T03090                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve00590  Arachidonic acid metabolism
lve00591  Linoleic acid metabolism
lve00592  alpha-Linolenic acid metabolism
lve01100  Metabolic pathways
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04072  Phospholipase D signaling pathway
lve04217  Necroptosis
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04611  Platelet activation
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04921  Oxytocin signaling pathway
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103090681 (PLA2G4F)
   00565 Ether lipid metabolism
    103090681 (PLA2G4F)
   00590 Arachidonic acid metabolism
    103090681 (PLA2G4F)
   00591 Linoleic acid metabolism
    103090681 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    103090681 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103090681 (PLA2G4F)
   04010 MAPK signaling pathway
    103090681 (PLA2G4F)
   04370 VEGF signaling pathway
    103090681 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    103090681 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103090681 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103090681 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    103090681 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    103090681 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103090681 (PLA2G4F)
   04913 Ovarian steroidogenesis
    103090681 (PLA2G4F)
   04921 Oxytocin signaling pathway
    103090681 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103090681 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    103090681 (PLA2G4F)
   04726 Serotonergic synapse
    103090681 (PLA2G4F)
   04730 Long-term depression
    103090681 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103090681 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103090681 (PLA2G4F)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103090681 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 103090681
NCBI-ProteinID: XP_007460206
UniProt: A0A340XFF3
Position
Un
AA seq 849 aa AA seqDB search
MLWALWPRWLTGKELPLVGAVLLQKRQKREPQWRRWRRETHPYYDLQVKVLRARNIRGAD
LLSKADCYVQLWLHTASPSPAQTRVVANCHDPEWNETFHYRVHGAVKNVLELTLYDKDVL
DSDQLSLLLFDLRSLKPHQPHRHTFPLSHQDSQELQVEFVLEDSQVPASEVITNGVLVAQ
PCLRIQGTLRGDGTAPHQEYGSRQIRLAVPGAYEKPQLLPLQPPLEAGLPATFTFHVNPV
LSSRLEVELGEKLTVLQSSPSAELEVQTSKLGEAGILLSSLALGREQQHVVALGEGQEVA
MSVKAEVSSGDLDLRLGFDLCDGEQEFLDKRKHVVSKALQQVLGLSQAPDSNQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGVLDAVTYLSGVSGSTWCISTLYKDPGWSQVALKGPIE
RAQARVCSSKMGAMSRERLKYYAQELGMRESRGHSASLVDLWGLLIEYFLYQGENPAKLS
DQQEAVSQGQNPYPIYASVNVCSNISGKDFAEWCEFTPHEVGLPKYGAYVPTELFSSEFF
MGRLLQLRPEPRICYLQGIWGSAFAASLDEIFLKTTGSGLGFLQRCRGSVNITDDHQKLQ
LHDPARLQTRLFTPQGPFSQAVLDIFTYRFTSAPNSNFTQGLCLHKDYVSGREFLAWKGS
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLSLQPQRAVDLILSFDYSLDAPFEVLQMTR
KYCLDRGISFPSTEVPPEDVKEPRECYLFAKAEDLRSPIVLHFPLVNRTFRTHLAPGVER
QTDEEKACGDFVINGPDTPYGMMNFTYQPQEFERLVALSRYNVLNNVETVRQALRLALGQ
RQAGDRAGG
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcgctctggcccaggtggctgacaggcaaggagctgcctctcgtgggtgcg
gtgttgctgcagaagagacagaagagggaacctcagtggaggcggtggcggcgggagacc
cacccatactatgacctccaggtgaaggtgctgagggccagaaatatccggggcgcagat
ctgttgtccaaagcagactgctacgtgcagctgtggctgcacacagcgtcccccagcccg
gcccagacaagggtggtagccaactgccatgaccctgaatggaacgaaaccttccactac
cgggtccacggtgccgtgaagaacgtcctggagctcaccctctacgacaaggacgtcctg
gacagcgaccagctctccctgctgctgtttgacctgaggagcctcaagccccaccaaccg
cacagacacaccttcccactcagccaccaggattcacaagagctgcaggtggaatttgtt
ttggaggacagccaggtgccggcgtctgaagtcatcaccaatggggtcctggtggctcaa
ccatgtctgagaatccagggcaccctcaggggagatgggacagccccacatcaagagtat
ggctccaggcagattcggctggcagtgcctggggcctacgagaagccccagctcttgccc
ctgcagcctcccctggaggcaggcctcccagccacgtttaccttccacgtgaacccggtg
ctcagttccaggctggaggtggagctgggagagaagctcacggtcctgcagagcagccca
agtgctgagctggaggtccagaccagcaagctgggcgaggcgggcatccttctctcctct
ctggccctaggtcgggagcagcagcatgtcgtggccctgggggagggccaggaggtggcc
atgagtgtgaaggcagaagtgagctctggggacctggacctgcgtcttggctttgacctc
tgtgacggggaacaggagtttctggataagaggaagcacgtcgtgtccaaggccctacag
caggtgctgggattgagccaggctcccgacagtaaccaggtgcctgtggtggccgtgctg
ggttcgggaggtggaacccgagccatgtcttccctctacggcagcctggccgggctacag
gagctcggcgtcctggacgctgtgacctatctgagtggagtctctgggtccacctggtgc
atctccacgctctacaaggacccaggctggtcgcaggtggccttgaagggccctattgag
cgcgcccaggcgcgggtctgcagcagtaagatgggggcaatgtccagggaacgcctgaag
tactatgcccaggagctggggatgcgggaaagcaggggccacagcgcttccctcgtcgac
ctctgggggcttctcattgaatatttcctataccagggggaaaatcctgccaagctgtct
gaccagcaggaggcggtcagccagggccagaacccttaccccatctacgccagtgtcaac
gtctgcagcaacatcagtgggaaagactttgcagagtggtgcgagttcaccccccatgag
gtcggcttacccaagtatggcgcttatgttcccactgagctctttagctcagagttcttc
atggggcgactgctgcagctccgccccgagccccggatttgctacctgcagggtatatgg
ggcagcgcgtttgcagccagcctggatgagatcttcctgaagaccaccggctcaggtctt
ggcttcctacagaggtgcagaggcagtgtaaacatcacagacgaccaccagaagctccag
ctgcacgacccagcgaggctgcaaaccaggctcttcaccccgcaagggcccttctcccag
gctgtgctggacatattcacctaccgctttacctcagccccgaactcgaacttcacccag
ggcctctgcctgcacaaggactatgtgtctggcagggagtttttggcctggaaaggttcg
cacccggatgccttccccaaccagctcactcccatgcgggactgtctgtacctggtggat
ggaggctttgccatcaactctccgttcccgctgagcctgcagccgcagagagccgtggac
ctcattctgtccttcgactactccctggatgccccttttgaggtcttacagatgacacgg
aagtactgcctggaccgaggcatctccttccccagcactgaggtgccccctgaggacgtg
aaggagccccgtgaatgctacctgtttgccaaggccgaggacctgcgctcacccatcgtg
ctgcacttccccctggtcaaccgtaccttccgcacacacctggccccaggtgtggaacga
caaacggatgaggagaaagcctgtggcgactttgtcatcaatgggccagacaccccctat
ggcatgatgaacttcacctaccagccccaggagtttgagcggctggtggcgctgagtcga
tacaacgttctgaacaacgtggagactgtgcggcaggccctccggctggctctgggccag
cgacaggctggggacagggctggaggctga

DBGET integrated database retrieval system