KEGG   Lacinutrix venerupis: BWR22_09120Help
Entry
BWR22_09120       CDS       T04680                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
lvn  Lacinutrix venerupis
Pathway
lvn00633  Nitrotoluene degradation
lvn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lvn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BWR22_09120
Enzymes [BR:lvn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     BWR22_09120
  1.-  
   1.-.-  
    1.-.-.-  
     BWR22_09120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: APY01499
Position
2021727..2022377
Genome map
AA seq 216 aa AA seqDB search
MIEDLSNRYTSKAYDKTKRVSAEDLATIEEVLRLSPSSINSQPWKFIVIKSDEAKQRFSN
TFNKKYQFNQPHATNASEIILFANKIHYNKEDFKKRLDASMAAGRMNQKGYDNMLTKAFG
FAEMVADENGNNSHWTKAQSYIALGNVLHTLARLNIDSTPMEGVDADEIKKEFAKELGDD
YECTFALAIGYHNGEKDYNRKLPKARMAKEDVIIEL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ataatcgaagatttaagcaatcgctatacatcaaaagcatacgataaaacaaaacgtgtc
tcagccgaagatttggctacaatagaagaagtattgcgcctatcaccttcctctatcaac
tcacaaccatggaaatttatcgtaattaaaagtgatgaagctaaacaacgtttctctaat
acttttaacaagaagtatcaatttaatcaaccacacgctacaaacgcttcagaaattatt
ctttttgcaaataaaatacattataacaaagaagattttaaaaaacgcttagacgctagc
atggctgctggacgtatgaatcaaaaagggtatgataatatgctaacaaaagcatttgga
tttgctgaaatggtggccgatgaaaacggaaacaatagtcattggacaaaagcacaatct
tacattgcactgggtaacgtattacacacattggctcgcttaaatatcgattctactcca
atggaaggtgttgatgcagatgaaattaaaaaagaatttgccaaagagttaggagatgat
tacgaatgtacttttgctttagctattggttatcataacggtgaaaaagattacaaccgt
aaattgcctaaagcacgaatggcaaaagaagatgtaattattgaactttaa

DBGET integrated database retrieval system