KEGG   Lacinutrix venerupis: BWR22_12165Help
Entry
BWR22_12165       CDS       T04680                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
lvn  Lacinutrix venerupis
Pathway
lvn00633  Nitrotoluene degradation
lvn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lvn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BWR22_12165
Enzymes [BR:lvn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     BWR22_12165
  1.-  
   1.-.-  
    1.-.-.-  
     BWR22_12165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Tobravirus_2B
Motif
Other DBs
NCBI-ProteinID: APY01031
Position
complement(2686192..2686851)
Genome map
AA seq 219 aa AA seqDB search
MNLKEILNWRYTTKEYDATKKISETDMAEIKNLLRMSPSSVNLQPWHFIVAETTEGKARI
AKGTQGFFSFNEPKVTNASAVVLFCVKTDADDAYYQHIADTEDKDGRFPNEDIKNGFLGA
VKAFAGIHKYDLKDQQHWMEKQVYLNIGSFLLGVATLGIDATPMEGIDVKALDEEFGLRE
KGYTSLVAVSLGYHAESDFNSTEKTPKSRLPESEIFTLI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaaattttaaactggagatacacaactaaggaatacgatgcaaccaaa
aaaatatctgaaacagatatggctgaaatcaaaaacttattaagaatgagtccttctagc
gtaaacctacaaccttggcactttattgttgcagaaactaccgaaggtaaagcacgcatt
gcaaaaggaacacaaggttttttcagttttaacgaacctaaagtaactaatgcttcagct
gtagttttattctgtgtaaaaacagatgcggatgatgcatattaccaacatattgcagat
accgaagataaagacggaagattcccaaatgaagatataaaaaacggattcttaggtgct
gtaaaagcttttgcaggtattcataaatacgatttaaaagaccaacaacattggatggaa
aagcaagtatatcttaacattggtagctttttattaggagttgcaactttaggaattgat
gcaacaccaatggaaggtattgatgtaaaagctttagatgaagaattcggattaagagaa
aaaggatacacatctttagtcgctgtgtcattaggatatcatgctgagtcagatttcaat
tcaactgaaaaaacaccaaaatctaggttaccagaaagtgaaatattcactttaatataa

DBGET integrated database retrieval system