KEGG   Lacinutrix venerupis: BWR22_13490Help
Entry
BWR22_13490       CDS       T04680                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lvn  Lacinutrix venerupis
Pathway
lvn00900  Terpenoid backbone biosynthesis
lvn01110  Biosynthesis of secondary metabolites
lvn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lvn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWR22_13490
Enzymes [BR:lvn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BWR22_13490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: APY01276
Position
2983142..2984440
Genome map
AA seq 432 aa AA seqDB search
MSTTISGFSKLSKSEKIDWIVSNYLSNSNTAKQTITQYFNADSKLQQLHDEFIENTISNY
YLPLGVAPNFEINGKTYAIPMAIEESSVVAAASNAAKFWMQRGGFKAKVISTTKIGQVHF
MFDGDFETLKKVFETVKPKLILDTKPITANMEKRGGGILDIELRNKTSDLNNYYQLHATF
ETLDAMGANFINSCLEQFSKTFKAEAEKHLNTSIEIVMSILSNYVPDCLVRAEVSCNVEE
LKHKGIEGKAFAEKFVRAVNIAEVEPHRAVTHNKGIMNGIDAVVLATGNDFRAIEAGVHA
YAIKNGKYTSLTHAKIEDGVFTFWMEIPLALGTVGGLTGLHPLVKIALNILGKPSAKELM
QIVAVAGLAQNFAALRSLTTTGIQEGHMKMHLMNILNQFNATNEEKEVIVNYFKTNTVTH
SAVVLELEKLRQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaacaatttctggtttttcaaaactatctaaatctgaaaaaatagactggata
gttagcaactacctttcaaactccaatactgcaaagcaaactattacgcagtattttaat
gcagacagtaaactacaacagcttcacgatgagtttatagaaaacactatttctaattat
tatttaccacttggtgtagctccaaatttcgaaattaacggaaaaacatacgcaatccca
atggctattgaagaaagctcggttgttgcagctgctagtaatgctgctaaattctggatg
caacgtggtggttttaaggctaaagtgatctctactacaaaaattggacaggttcatttt
atgtttgatggcgattttgaaactttaaaaaaagtttttgaaaccgttaaacctaaatta
atattagataccaaaccaataaccgccaacatggaaaaacgtggtggtggaattttagat
attgagttaagaaataaaacttctgatttaaataactattatcaacttcatgcaaccttt
gaaacattagatgctatgggagcgaattttataaattcgtgtttagagcaattttccaaa
acgtttaaagctgaagcagaaaaacacttaaatacctctattgaaatagttatgagtatc
ctttctaactatgttccagattgcttagttagagcagaggtttcttgtaatgttgaagaa
ttaaaacataagggtattgaaggcaaggctttcgccgaaaagtttgttcgcgcagtaaat
attgcagaagtagagccacatagagctgttacacacaacaaaggtataatgaatggcatt
gatgccgtagtacttgctaccggtaacgattttagagctattgaagctggtgtgcatgct
tatgcaataaaaaatggaaaatacactagtttaactcatgcaaagattgaagatggtgta
tttactttctggatggaaataccattggcattaggaaccgttggaggtcttaccggatta
catcctttagttaaaatcgctttaaatattttaggaaaaccatcagctaaagaacttatg
caaattgtagctgttgctggtttagctcaaaattttgcagctttacgctcattaactaca
acaggaatacaagaaggacacatgaaaatgcatttaatgaatattttaaatcaatttaac
gctactaacgaagaaaaagaagttatagtaaattattttaaaactaatacagtaacacat
agtgctgtggttttagaattagaaaaactaagacagtaa

DBGET integrated database retrieval system