KEGG   Yoonia vestfoldensis: LOKVESSMR4R_00148Help
Entry
LOKVESSMR4R_00148 CDS       T04854                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00260  Glycine, serine and threonine metabolism
lvs01100  Metabolic pathways
lvs01110  Biosynthesis of secondary metabolites
lvs01120  Microbial metabolism in diverse environments
lvs01130  Biosynthesis of antibiotics
lvs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LOKVESSMR4R_00148 (ltaE)
Enzymes [BR:lvs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LOKVESSMR4R_00148 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ART99490
UniProt: A0A1Y0E802
Position
complement(148272..149318)
Genome map
AA seq 348 aa AA seqDB search
MFFASDNAGPAHPKVMDALVKANSGYALGYGADPIMAEVRQQIRDIFEAPEAAVYLVING
TSANALLLATMCQPWQTIFCTDVAHIHEDECNAPEFYTQAKLTLVPTTAGKMTADALRAK
IKAEETRGVHGPQRGPVSVTQVTEKGTVYSLAEIKALTDIAREYGLPAHLDGARFANALV
ALDCTPAEMTWKAGIDAVSFGGTKNGAMGVEACVIFDPKLAWEFELRRKRGGHLLSKHRY
LSAQMQAYLADGLWLDMARAANARCAQLAEGLRRHNVARMLCDPAANIIFFEMPRQDHQR
MLAAGAVYYVMSGDPDQGDPDEMLTARLVTDWSMTADGVSQFLGLLHG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcgcctctgacaatgcaggccccgcgcatcccaaggtgatggatgcgctggtc
aaggcaaattccggctatgccttgggctatggtgccgacccgatcatggccgaggtgcgc
cagcagatccgcgatattttcgaagcccccgaggcggcggtctatctggtgatcaacggc
acatcggccaatgcgctgctgctggccacgatgtgccagccctggcagacgattttctgc
accgatgtcgcccatatccacgaagatgaatgcaacgcgcccgaattctacacccaggcc
aaactgaccctggtacccacaacggctggtaaaatgaccgccgacgccctgcgcgccaag
atcaaggccgaggaaacgcgcggcgttcacgggccgcagcgggggcctgtgtcggtgaca
caggtgacggaaaaaggcaccgtttattctttggctgagatcaaggcgctgaccgatatc
gcgcgcgaatacggcctgcccgcccatctggacggcgcgcgttttgccaatgcgctggtc
gccctcgattgcacacctgcggaaatgacatggaaagcgggcattgacgcggtcagtttc
ggcggcaccaagaatggcgcgatgggcgtcgaggcttgcgtgatctttgaccccaaactg
gcatgggaattcgagctgcgccgcaaacgcggtgggcatctgctgtccaagcatcgctat
ctgtcagcgcagatgcaggcctatctggcggacgggctctggcttgacatggcgcgcgcg
gccaatgcgcggtgtgcgcaactggccgaagggctgcggcgacacaacgtggcgcggatg
ctgtgcgaccccgctgccaatatcatctttttcgagatgccccgccaggatcatcagcgg
atgctggctgcgggggctgtctattacgtcatgtcgggcgatcccgatcagggcgatccc
gatgaaatgctgaccgcccgtctggtcaccgattggtcgatgacggcggatggggtcagc
cagttccttggtctgctgcacggataa

DBGET integrated database retrieval system