KEGG   Yoonia vestfoldensis: LOKVESSMR4R_00176Help
Entry
LOKVESSMR4R_00176 CDS       T04854                                 

Gene name
mdlY
Definition
(GenBank) mandelamide hydrolase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00970  Aminoacyl-tRNA biosynthesis
lvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOKVESSMR4R_00176 (mdlY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lvs03029]
    LOKVESSMR4R_00176 (mdlY)
Enzymes [BR:lvs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LOKVESSMR4R_00176 (mdlY)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LOKVESSMR4R_00176 (mdlY)
Mitochondrial biogenesis [BR:lvs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LOKVESSMR4R_00176 (mdlY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ART99518
UniProt: A0A1Y0E7X2
Position
176334..177662
Genome map
AA seq 442 aa AA seqDB search
MQDWRWMTAADLGRGIAAGAIDPVALTEVYLAAIDAHEYRDRIYARVTHARARAEAKAAA
ERAASGFRRGPLDGVPVSWKDLFDSAGIGTEAGTALMAGRVPISDAAVLDTATAAGLVCL
GKTHMSEIAFSGLGLNPITATPPCVNDVAAVAGGSSSGAAASVAFGLAAAGIGTDTGGSV
RIPAAWNDLVGLKTSHGRLSLEGVVPLCLTFDTVGPLCRSVEDAALLLAALEGSGPVDLG
GADLTGMRLMVLDTIVPEDMRDAPRAAFAASVAKLRAAGAQIEHRYFSQLFDAFNIAGNL
YAADSYGWWRDRVEAHPEKMFPQILERVRGGKTVSGPDFVEGWNILRRIRKEYAAETAPF
DAVIMATAPMLPPQAARLLTDDAYYKSENLLALRNTRVANLLDVCSITLPTGVPSCGIMF
NGQTGSEARLLRLAAAAARALR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcaggactggcgctggatgactgccgcggatctggggcgcgggattgcagcgggggcg
attgaccccgtggcgctgaccgaggtctatcttgccgccattgatgcgcatgaataccgc
gaccggatctatgcccgcgtcacccatgcccgcgcccgcgccgaggcgaaagcggcggca
gagcgcgcggcctcggggttccggcgcgggcctttggacggtgtgccggtgtcgtggaag
gatctgttcgacagcgccggtatcgggaccgaggcaggcaccgccctgatggcgggccgc
gtgcccatatccgatgccgccgtgctggacaccgcgacggcggcggggctggtctgtctg
ggcaagacccatatgtcggaaattgccttttccgggctggggttgaacccgatcaccgcc
acgccgccttgtgtcaatgacgtggctgccgtggcgggcgggtcgtcatcgggggcggcg
gcctcggtggcctttggccttgctgcggcggggatcggcacggatacgggcgggtcggtg
cgcatccctgcggcctggaacgatcttgtggggctgaaaaccagccatggccggctgtcg
ctggagggggtcgtgccgctctgcctgaccttcgacacggtcggcccgctatgccggtcg
gtcgaggatgccgcattgctgctggccgcattggaagggtcgggccctgtcgatctgggc
ggcgctgatctgaccggcatgcggttgatggtgctggacacaatcgtgcccgaggatatg
cgcgacgccccccgcgcggcattcgcggcgagtgtcgcgaaattgcgcgcagcaggcgcg
cagatcgagcatcgctatttttcgcagcttttcgatgcgttcaatatcgcgggcaatctt
tatgccgctgacagctatggctggtggcgtgaccgggtcgaggcgcatcctgaaaagatg
tttccccagatcctggagcgggtgcgcggcggcaagacagtctctggtcccgattttgtc
gagggctggaacatcttgcgccggatccgcaaagaatatgccgccgagaccgcgccattc
gatgctgtcatcatggccaccgcgccgatgctgccgccgcaggctgcgcgattattgacc
gatgatgcctattacaaatccgaaaacctgctggccttgcgcaatacacgcgtggcgaac
ctgttggatgtctgttcgatcacgctgcccacgggtgtgccgtcctgcgggatcatgttc
aacgggcagaccgggtccgaggcgcggctgctgcggctggcggcagcggcggcgcgggcg
ttgcgataa

DBGET integrated database retrieval system