KEGG   Yoonia vestfoldensis: LOKVESSMR4R_00509Help
Entry
LOKVESSMR4R_00509 CDS       T04854                                 

Gene name
fadA
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00071  Fatty acid degradation
lvs00072  Synthesis and degradation of ketone bodies
lvs00280  Valine, leucine and isoleucine degradation
lvs00310  Lysine degradation
lvs00362  Benzoate degradation
lvs00380  Tryptophan metabolism
lvs00620  Pyruvate metabolism
lvs00630  Glyoxylate and dicarboxylate metabolism
lvs00640  Propanoate metabolism
lvs00650  Butanoate metabolism
lvs00900  Terpenoid backbone biosynthesis
lvs01100  Metabolic pathways
lvs01110  Biosynthesis of secondary metabolites
lvs01120  Microbial metabolism in diverse environments
lvs01130  Biosynthesis of antibiotics
lvs01200  Carbon metabolism
lvs01212  Fatty acid metabolism
lvs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOKVESSMR4R_00509 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LOKVESSMR4R_00509 (fadA)
   00640 Propanoate metabolism
    LOKVESSMR4R_00509 (fadA)
   00650 Butanoate metabolism
    LOKVESSMR4R_00509 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOKVESSMR4R_00509 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LOKVESSMR4R_00509 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOKVESSMR4R_00509 (fadA)
   00310 Lysine degradation
    LOKVESSMR4R_00509 (fadA)
   00380 Tryptophan metabolism
    LOKVESSMR4R_00509 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOKVESSMR4R_00509 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOKVESSMR4R_00509 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LOKVESSMR4R_00509 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lvs04147]
    LOKVESSMR4R_00509 (fadA)
Enzymes [BR:lvs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOKVESSMR4R_00509 (fadA)
Exosome [BR:lvs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOKVESSMR4R_00509 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ART99847
UniProt: A0A1Y0E8L9
Position
complement(509035..510246)
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDAIRTPRGKGRADGSLHEVTSARLSAGVLNALKERNNLQGHAVEDVIWGNVTQ
VGEQGGCLARTAVLASDLDESIPGLAINRFCASGMEAVNLAANQVRGGAGQAYIAGGVEM
MGRVAMGSDGAAIAVDPSIAMDSYFVPQGISADIIATEYGFSRDAADQLAVESQKRAKAA
WDEGRFAKSVVTVRDINGLAILDHDEYMRPETNMQTLGSLNPAFAAMGEVMPGFDKIALM
KYPHLERINHIHHAGNSSGIVDGAAGVLVASKEWGEAMGLKPRAVIRATAKIGTDPTIML
TGPVPVTEKILRDAGMAISDIDLFEVNEAFASVVLRFMQAFNVDHDRVNVNGGSIAMGHP
LGATGAIIIGTLLDELERSGKSTGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcctatatctatgacgcgatccgcacgccgcgcggcaaaggccgcgccgat
ggcagcctgcacgaggtgacatccgcccgcctgtccgccggtgtgctgaacgcgctgaaa
gagcgcaacaacctgcaaggccacgcggtcgaggatgtgatctggggcaatgtcacacag
gttggcgaacagggcggctgtctggcgcgcacggcggtgctggcgtccgatctggacgaa
tccatccccggtctggcgatcaacaggttctgcgcctctggcatggaagcggtgaacctt
gccgccaatcaggtgcgcggcggggccggtcaggcctatatcgcgggcggcgttgaaatg
atgggccgcgtcgccatgggcagcgacggggcggcgattgcggttgatccgtcgattgcg
atggacagctatttcgtcccgcagggcatttccgccgatatcatcgccactgaatacggt
ttcagccgtgacgcggccgaccaattggccgtcgaaagccagaaacgcgcgaaggccgcg
tgggacgaaggccgtttcgccaaatccgtcgtgacggtgcgcgatatcaacggtttggcc
attctggaccatgacgaatacatgcgaccagaaacgaatatgcaaacgcttgggtcgctg
aaccccgcctttgccgccatgggcgaggtgatgcccggcttcgacaagatcgcgctgatg
aaatacccccatctggaacggatcaaccatatccaccatgcgggcaattcatcgggcatc
gtcgatggtgccgctggcgtgctggttgcgtcgaaggaatggggcgaggcgatgggcctc
aaaccccgcgcggtgatccgtgcgactgcgaaaatcggcactgatccgacgatcatgctg
accggcccggtgcccgtgaccgagaaaatcctgcgggatgccggcatggcgatcagcgat
atcgacctgttcgaggtgaacgaggcttttgcctccgtcgtgctgcggttcatgcaggcg
ttcaacgtcgatcatgaccgcgtcaacgtcaacggcgggtccatcgcgatggggcatcct
ttgggggccaccggtgcgatcatcatcggcaccctgctggatgaattggaacgctctggc
aaatccaccggtctggcgacgctctgcatcgcatcgggcatgggtgccgcaacgattatc
gaacgcgtgtaa

DBGET integrated database retrieval system