KEGG   Yoonia vestfoldensis: LOKVESSMR4R_02641Help
Entry
LOKVESSMR4R_02641 CDS       T04854                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00670  One carbon pool by folate
lvs01100  Metabolic pathways
lvs01120  Microbial metabolism in diverse environments
lvs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LOKVESSMR4R_02641 (metF)
Enzymes [BR:lvs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LOKVESSMR4R_02641 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Peptidase_S32 DUF3895
Motif
Other DBs
NCBI-ProteinID: ARU01936
UniProt: A0A1Y0EE73
Position
2626940..2627806
Genome map
AA seq 288 aa AA seqDB search
MSSPSVSFEFFPPKSLEGSFRLWDCVNVLAPLDPTFVSVTYGAGGTTRQLTHEAVSTIHR
TSGLNVAAHLTCVDATRAETLEIAQNYAAAGVREIVALRGDAPKGQATFTAHDDGFASSV
ELIAALAETGQFTIRVGAYPEKHPEAADQAADIAFLKRKIDAGATSAITQFFFEADTFFR
FRDACVKAGITAPIIPGILPIENWTGTQKFAAQCGTHIPQVIRDAFTNATRDGTTDLLAT
ALATELCDDLVRGGVDDLHFYTLNRPELTRDVCHALGVTPKARLQNVA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcccgtccgtttcttttgaattctttccgcccaaatcgctcgaagggtcgttc
cggctgtgggattgcgtcaatgtcttggcgccgctggacccgacctttgtgtcggtgacc
tatggggcgggcggcacgacacgccagctgacccatgaggcggtcagcacgatccaccgc
accagcgggctgaatgttgccgcacatctgacctgtgtcgatgcgacccgcgctgaaacg
cttgaaatcgcgcagaattatgccgcagcgggcgtgcgcgaaatcgtcgccctgcgcggt
gatgcccccaaggggcaggcgacattcaccgcccatgacgacggttttgccagttcggtc
gagctgatcgccgcccttgccgagaccggacaattcacgatccgcgtcggcgcctatcct
gaaaagcaccccgaagccgccgatcaggccgccgatatcgcctttctcaagcgcaagatc
gatgccggtgcgacatctgcgatcacgcagttctttttcgaggccgatacttttttccgg
ttccgcgatgcctgtgtcaaagcgggaatcaccgcaccgatcattccgggcattctgccg
attgaaaactggaccgggacgcagaaattcgcagcgcaatgcgggacgcatattccgcag
gtgatccgcgatgcgttcaccaacgccacccgcgacggcacgaccgacctgctggccacg
gcgctggcgaccgagctttgcgacgatctggtgcgcggcggggtggatgatctgcatttc
tatacgctcaaccggcccgaactgacgcgcgatgtctgccatgcgctgggggtcacgccc
aaagcacggttgcaaaacgtcgcctga

DBGET integrated database retrieval system