KEGG   Yoonia vestfoldensis: LOKVESSMR4R_02838Help
Entry
LOKVESSMR4R_02838 CDS       T04854                                 

Gene name
mcl1
Definition
(GenBank) L-malyl-CoA/beta-methylmalyl-CoA lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs00630  Glyoxylate and dicarboxylate metabolism
lvs00660  C5-Branched dibasic acid metabolism
lvs00680  Methane metabolism
lvs01100  Metabolic pathways
lvs01120  Microbial metabolism in diverse environments
lvs01200  Carbon metabolism
Module
lvs_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LOKVESSMR4R_02838 (mcl1)
   00660 C5-Branched dibasic acid metabolism
    LOKVESSMR4R_02838 (mcl1)
  09102 Energy metabolism
   00680 Methane metabolism
    LOKVESSMR4R_02838 (mcl1)
Enzymes [BR:lvs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     LOKVESSMR4R_02838 (mcl1)
    4.1.3.25  (S)-citramalyl-CoA lyase
     LOKVESSMR4R_02838 (mcl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: ARU02129
UniProt: A0A1Y0EFC6
Position
2820760..2821719
Genome map
AA seq 319 aa AA seqDB search
MSFRLQPAPPARPNRCQLFGPGSNTKLFAKMAASAADVINLDLEDSVAPSDKDSARANVI
EAINTVDWGNKTLSVRINGLDTPYWYRDVVDLLEQAGDRLDQIMIPKVGCAADVYAVDAL
VTAIERAKGRARPISFEVIIESAAGIAHVAEIAASSPRMAAMSLGAADFAASMGMQTTGI
GGTQDNYYMLHGDTRHYADPWHWAQTAIVAACRTHGVLPVDGPFGDFSDDEGYRAQARRS
ATLGMVGKWAIHPKQIALANEVFTPSDAAVAEAREILAAMEQAKARGEGATVYKGRLVDI
ASIKQAEVIVRQSQMISGA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcattccgcctgcagcctgcaccgcctgcccgtccgaaccgttgccaattatttggc
cccggatcgaataccaagctgtttgccaagatggcggcctcggcggcagatgtgatcaac
cttgatctggaagacagcgtcgcgccatcggacaaggacagcgcgcgcgccaatgtgatc
gaggcgatcaatactgtggattggggcaacaagacgctgtctgtccggatcaacgggctg
gacacgccctattggtatcgcgacgttgtcgatctgctggaacaggcgggcgacaggctc
gaccagatcatgatccccaaggtcggctgcgccgcagatgtctatgccgtggatgcgctc
gtcaccgcgattgaacgggccaagggccgcgcgcggcccatcagtttcgaggtcatcatc
gaatcggccgccggtatcgcccatgtcgcggaaatcgccgccagctcgccgcgcatggcc
gccatgtcgctgggggcggcggatttcgcggcttcgatggggatgcagacaaccggtatc
ggcggaacgcaggacaattattacatgctgcatggtgacacgcgccattatgccgatcca
tggcattgggcgcagaccgcgattgtcgccgcttgccggacccatggcgtgctgcccgtc
gatggcccctttggcgatttcagcgatgacgaaggctaccgcgcacaggcgcgccggtcc
gcgacgctgggcatggtcggcaaatgggcgatccaccccaagcagatcgcccttgccaat
gaggtcttcaccccatccgacgccgctgttgccgaggcgcgcgagattctggcggcgatg
gaacaggccaaggcccgcggcgaaggcgcgaccgtctacaaaggccgccttgtcgatatc
gcctcgatcaagcaggccgaggtgatcgtgcgccaatcgcagatgatcagcggcgcgtaa

DBGET integrated database retrieval system