KEGG   Listeria welshimeri: lwe0302Help
Entry
lwe0302           CDS       T00422                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lwe  Listeria welshimeri
Pathway
lwe00010  Glycolysis / Gluconeogenesis
lwe00051  Fructose and mannose metabolism
lwe00562  Inositol phosphate metabolism
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
lwe01230  Biosynthesis of amino acids
Module
lwe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lwe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe0302
   00051 Fructose and mannose metabolism
    lwe0302
   00562 Inositol phosphate metabolism
    lwe0302
Enzymes [BR:lwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lwe0302
Exosome [BR:lwe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lwe0302
  Exosomal proteins of bladder cancer cells
   lwe0302
  Exosomal proteins of melanoma cells
   lwe0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAK19720
UniProt: A0AFD8
Position
complement(326246..327010)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAGTSEWLEATIPLLENFTDVDTFIFPSMGTLETTASLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLKANYVEIGHAERKNLFHEKSSEIAKKIKLALDE
KITPVVCVGESVRANNTDELKMALNKQIEALFEAINVAQWENVVLAYEPEWAIGKSSSAD
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVHQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaattacattaatacgcgggctggaaca
tcggaatggttagaagcaactattcctctccttgaaaattttactgatgtggatacgttt
atctttccatctatgggaacactcgaaacgactgccagccttttagcgggtacatcattt
ggttttggaccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttca
gtggaatcaatcattgacctgaaagcaaactatgtcgaaattggccacgcggaacgcaag
aacctttttcatgagaaaagcagtgaaatagccaaaaaaattaaactcgcactggacgaa
aaaatcactccagttgtgtgtgtaggtgaaagtgttcgcgcgaataacacagatgaatta
aaaatggcgctaaacaaacaaatagaagcactgtttgaagcaattaatgtagcacagtgg
gaaaatgttgttctggcttatgaaccagaatgggcaattggcaagtcctcttccgctgac
accaattatatcgaaagcgctcatcaagctttgcgcgaaattatccgcgaacttggcggc
gatgaaacgcttgtaaggattatttatggcggttcggtcagcaaagaaaatgccgcagaa
attgttcatcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtctctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system