KEGG   Listeria welshimeri: lwe0704Help
Entry
lwe0704           CDS       T00422                                 

Definition
(GenBank) ribulose-5-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
lwe  Listeria welshimeri
Pathway
lwe00030  Pentose phosphate pathway
lwe00040  Pentose and glucuronate interconversions
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
lwe01230  Biosynthesis of amino acids
Module
lwe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lwe_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lwe0704
   00040 Pentose and glucuronate interconversions
    lwe0704
Enzymes [BR:lwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     lwe0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim NanE TMP-TENI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAK20122
UniProt: A0AGJ0
Position
731336..732007
Genome map
AA seq 223 aa AA seqDB search
MTKKLLCPSMMCADFSNLQKEIEELDRAGSDIFHIDIMDGEFVPSFGMGLQDFKEIRNKT
QKLVDVHLMIMNPGNYVELFADSGADIIYIHPEADKHPARTLDKIRKKGKKTGVAINPGT
AISTIKELLPLVDYLMVMTVNPGFSGQTYLDYVDDKIIELVQLKKKYPFEIMVDGAISPE
KIAKLSKIGVRGFVLGTSALFGKKEDYAKIIKHLKQEDMEEVR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaattgctttgcccctcaatgatgtgtgctgatttttctaatctccaaaag
gaaattgaagaactagaccgagctggaagtgacatctttcatatagatataatggatggt
gaatttgtaccgagctttggcatgggattgcaagattttaaagaaattcgaaataaaacg
cagaaactagtggatgttcatttaatgataatgaatccaggtaactatgtggagttattt
gctgattcgggtgccgatattatttatattcatccagaagcagataaacatccagcaaga
actttagacaaaatacgaaaaaaagggaagaaaacaggtgtggctattaatcctggaact
gctatttctacgataaaagaacttttgccattagtagattatttgatggtgatgactgtt
aatccgggcttttcgggtcaaacgtatcttgattatgtggatgacaaaataatagaactg
gttcaattaaaaaagaaatatccctttgaaattatggtcgatggggctatatctccagaa
aaaattgctaaactttctaaaattggcgtccgaggatttgtacttggaacctcagcgcta
tttggtaaaaaagaggactatgctaaaattattaaacatttaaaacaagaagatatggag
gaagtacgatga

DBGET integrated database retrieval system