KEGG   Listeria welshimeri: lwe1030Help
Entry
lwe1030           CDS       T00422                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lwe  Listeria welshimeri
Pathway
lwe00010  Glycolysis / Gluconeogenesis
lwe00020  Citrate cycle (TCA cycle)
lwe00620  Pyruvate metabolism
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
Module
lwe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe1030 (pdhC)
   00020 Citrate cycle (TCA cycle)
    lwe1030 (pdhC)
   00620 Pyruvate metabolism
    lwe1030 (pdhC)
Enzymes [BR:lwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lwe1030 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 NQRA RnfC_N GCV_H HlyD_D23 DUF896
Motif
Other DBs
NCBI-ProteinID: CAK20448
UniProt: A0AHG6
Position
1046500..1048134
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPKPAQTSGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPATGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTSAQTEEKASAPKAEKT
AAKQSVPSSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataagattgaagaagatgaatccctatttgaagttcaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagtggctacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actccgaaacccgcacaaactagcggaaaaggaattttcgaatttaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtgcaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgttaaagatattttagttagtgaaggtacagtagcaacagttggt
caagtattagtaacatttgaaggtgattttgaaggagaagcaagtcatgaatctactcca
gaatccccagcagaagaagctgaacttacaaataacgatgcaacttccgcaccagcaaca
ggtggaaacggaactccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgctcgtgaaaaaggcgttaatattgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggcgaacaaccagct
gcagcaactacttctgctcaaacagaagaaaaagcatctgcaccaaaagcagaaaaaaca
gctgcaaaacaatctgttccaagttccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcaattgcaaaagcaatggtaaactcgaaacatacagcaccgcacgtt
acgctaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaactaactttcttaccttatatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagacgatgcaactgaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatatgta
ccagtaattaaaaatgctgacaaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaacagctgacgaaatgcgccacggttccgca
actatttctaatattggttctgccggtggacaatggttcactccagtaattaattaccca
gaagttgctatcctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtattagcgctttccttaagctttgaccaccgtgtcattgacgga
gcaactgctcaaaaagcaatgaacaatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system