KEGG   Listeria welshimeri: lwe1059Help
Entry
lwe1059           CDS       T00422                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lwe  Listeria welshimeri
Pathway
lwe00040  Pentose and glucuronate interconversions
lwe00052  Galactose metabolism
lwe00500  Starch and sucrose metabolism
lwe00520  Amino sugar and nucleotide sugar metabolism
lwe01100  Metabolic pathways
lwe01130  Biosynthesis of antibiotics
Module
lwe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lwe1059 (galU)
   00052 Galactose metabolism
    lwe1059 (galU)
   00500 Starch and sucrose metabolism
    lwe1059 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    lwe1059 (galU)
Enzymes [BR:lwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     lwe1059 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: CAK20477
UniProt: A0AHJ5
Position
complement(1079099..1079986)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELELNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDEYSKN
LYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVAKLVDQLYAEIHSKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagcagtcattccagcagcaggattagggacgagatttctgcctgcc
acaaaagcaatgcctaaagaaatacttccaatagtagacaagccaaccattcaatacata
gtagaagaagcggtagaatctggaattgaagatattctaatcgttactggtaaaggaaaa
agagctattgaagaccactttgactccgttcctgaacttgagcttaacctacgcgaaaaa
aacaaactagaattacttcatttaattgaagaaacaacaaatattaaccttcacttcatt
cgtcaatctaaacctaaaggacttggtgatgcgattcttcaagctagagggtttgtgggt
aatgagccatttattgttatgttaggtgatgacattgttcaagcaaaaacaccatgtgca
aaacagttaatagatcaatacgaaaaaacacatagttctatcattggagttcaaacggtt
cctcatgaagaaacttatcgttatggcattatcgatccaattgatgaatatagtaaaaac
ctatacaatgtaaatggttttgtagaaaagcctgatccaagtgcagcgccttctgacctt
gctattcttggtagatatctactaacaccgcagatttttgacttcttagaaacacaaaaa
cctggtgctggtggcgaaatccaattaactgacgctatcaacagtttaaatgaaattcaa
cgagtttttgcttatgattttgaaggagaacgctttgatgttggtgataaattcggtttt
atcaagacgaccatgcaatttgctttaaagcatccagaaattaaggatgatgttgcaaaa
ttggtagatcagctttatgcagaaattcactcgaaggataaaaaataa

DBGET integrated database retrieval system