KEGG   Listeria welshimeri: lwe1431Help
Entry
lwe1431           CDS       T00422                                 

Definition
(GenBank) acetyl-CoA acetyltransferase/HMG-CoA reductase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lwe  Listeria welshimeri
Pathway
lwe00071  Fatty acid degradation
lwe00072  Synthesis and degradation of ketone bodies
lwe00280  Valine, leucine and isoleucine degradation
lwe00310  Lysine degradation
lwe00362  Benzoate degradation
lwe00380  Tryptophan metabolism
lwe00620  Pyruvate metabolism
lwe00630  Glyoxylate and dicarboxylate metabolism
lwe00640  Propanoate metabolism
lwe00650  Butanoate metabolism
lwe00900  Terpenoid backbone biosynthesis
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01200  Carbon metabolism
lwe01212  Fatty acid metabolism
lwe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lwe1431
   00630 Glyoxylate and dicarboxylate metabolism
    lwe1431
   00640 Propanoate metabolism
    lwe1431
   00650 Butanoate metabolism
    lwe1431
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lwe1431
   00072 Synthesis and degradation of ketone bodies
    lwe1431
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lwe1431
   00310 Lysine degradation
    lwe1431
   00380 Tryptophan metabolism
    lwe1431
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lwe1431
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lwe1431
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lwe1431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lwe04147]
    lwe1431
Enzymes [BR:lwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lwe1431
Exosome [BR:lwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lwe1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAK20849
UniProt: A0AIL7
Position
complement(1424883..1426052)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAARTPIGKFGGSLKDVSAVDLGAIALKGVLERANIAPERIDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKAIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPEFYGEEIDSKNLKNSMLIDGLTDVYGEYHMGITAENVAKKFAVSREEQDKFAH
NSQMKAANAQEKNLFEEEIVPVRLPNGSFFEGDETIRANSTLEKLATLKSVFQEDGTVTA
GNSSGINDGASAVILMSKEKAIAENIPYLATIKVTSEVGVDPAIMGYAPYYAVNEALAKG
EYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIVVSLLN
ELKHENKQVGLASLCIGGGIGIAIVIERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgccgctcgaacaccaattggaaaatttggtggtagt
ttgaaagatgtaagtgcagtagaccttggtgctatcgctttaaaaggcgttttagaaaga
gccaacatcgctccagaacgcatagaccaagttatttttggaaatgttttacaagcaggt
cttggtcaaaacgtggctagacaagtagctatcaaagccggaataccttataaagtccca
ggtgtgacaattaatgaagtttgtggatcaggtttaaaagccattatgcttggtagacaa
gctattcaactcggggaggccgatatcgtagcagtaggagggactgaaaatatgtctcaa
gctcctttattacttaaccctgaattttatggcgaagaaattgattcgaaaaacttaaag
aatagtatgctgattgatggattaacagatgtttatggtgaatatcatatgggaattaca
gctgaaaatgttgccaaaaaatttgctgtatcgagagaagaacaagacaaatttgcccat
aattcgcaaatgaaagccgcaaatgcccaagaaaaaaatctttttgaagaagaaattgtt
cctgttcgcttaccgaatggttcatttttcgagggtgacgaaacaatccgagctaattct
acgttagaaaaattagctactttgaaaagtgtttttcaagaagatggaacagttactgct
ggtaattcttctggtatcaatgatggagcttctgctgttatattaatgtctaaagaaaag
gcaattgctgaaaatattccttatttggctacaatcaaagttacttcagaagtaggtgtt
gatccggcgattatgggctatgcaccatattatgcagtaaatgaagctttagcaaaaggt
gagtactctatagatgatattgatttattccacttaaatgaagcttttgcctctcaatca
gtggcagtagctagagatttgaaaatacctgaagagaaacttaacatatatggtggagca
atcgcattaggtcatccaattggtgcttctggtgctcgtattgttgtttcgttattaaat
gaattaaaacatgaaaataaacaagtcggtttagcttccttatgtattggtggcggtatt
ggaatcgctattgttattgaaagagcttaa

DBGET integrated database retrieval system