KEGG   Listeria welshimeri: lwe2038Help
Entry
lwe2038           CDS       T00422                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
lwe  Listeria welshimeri
Pathway
lwe00300  Lysine biosynthesis
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
lwe01230  Biosynthesis of amino acids
Module
lwe_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lwe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    lwe2038 (dapF)
Enzymes [BR:lwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     lwe2038 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: CAK21456
UniProt: A0AKC4
Position
complement(2072726..2073712)
Genome map
AA seq 328 aa AA seqDB search
MAIIHFTKVHGSQNDFFLVDEEENHITAWSDTKRADFAIKLCDRSHSLGGADGILYVAKS
NKAGAIGQMRVVNSDGSIASMCGNGLRTVARYLLEKHALTDAKVETMKAILDVRKATSLG
FDIPTYQVEISPVKFNPESLPMYVGVEKLFNQVIPELDEELAFSAVSVPNPHLITFVDQT
VLDSDKQEKLASFLNSENPYFPDGVNVSFVKRLNEDAIYVRTFERGVGFTNACGTAMSAC
SLIKKMLDQDTLETPLNVYNDGGRVQVTAKKDETGDISLQLIGNATFVSTGSVRYDDIVT
ELTNEATVEQAQYQELVQEVKHFLKTTG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcaataattcactttacaaaagtacatggttcgcaaaatgattttttcttagttgat
gaagaagaaaatcatattactgcttggtctgatacaaaacgagctgattttgcgataaaa
ctttgcgacagaagtcattcgctaggcggggctgatggtattttatatgttgcaaaaagc
aataaagcgggagcgattggtcaaatgcgtgtcgttaattcagatggttcgattgcttcg
atgtgtggtaacggcttaagaacggtagcccgctatttacttgaaaagcacgcattgaca
gacgcaaaagtggaaacaatgaaagcgatactagatgttcgaaaagcaacttcacttggt
tttgatattccaacgtatcaagtcgaaatttctccggttaaatttaatccagaaagttta
ccaatgtatgtaggcgtggaaaaattatttaatcaagttattccagaacttgacgaagag
ctcgctttttcagctgtttctgttccaaatccccatttaattacatttgtagatcaaacc
gtcttagattccgataaacaagaaaaattagcgagttttttaaatagcgaaaacccttat
tttccagatggtgtaaatgtgagttttgtgaaacgcctgaatgaagatgctatttatgtg
cggacttttgaacgcggtgttggatttacgaacgcttgcggaacagcaatgtcggcatgt
agtttaattaaaaaaatgttagatcaggatactttggaaacaccactcaatgtttataat
gatggtggtagagtgcaagtaactgcgaaaaaagacgaaacaggcgacatttcgttacaa
ctaattggtaatgcgacattcgttagtactggttctgttcgttatgatgatatagttact
gagctcacaaatgaagcgacagtagaacaagcgcaatatcaagaacttgttcaagaagta
aaacattttttaaaaacaactggatga

DBGET integrated database retrieval system