KEGG   Listeria welshimeri: lwe2126Help
Entry
lwe2126           CDS       T00422                                 

Gene name
feoB
Definition
(GenBank) ferrous iron transport protein B
  KO
K04759  ferrous iron transport protein B
Organism
lwe  Listeria welshimeri
Brite
KEGG Orthology (KO) [BR:lwe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lwe02000]
    lwe2126 (feoB)
Transporters [BR:lwe02000]
 Other transporters
  Others
   lwe2126 (feoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate FeoB_C MMR_HSR1 FeoB_Cyto SRPRB Parvo_NS1
Motif
Other DBs
NCBI-ProteinID: CAK21544
UniProt: A0AKL2
Position
2157596..2159590
Genome map
AA seq 664 aa AA seqDB search
MSQNTYCLLGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTLRSKTGKLIDLPGIYD
LNPISRDETVVTRFLLEEKFDCMLNIVDSSQIERNLNLTIQLLEFGAPVVMGLNMVDVAA
GRGIHLNIQNLAKKLRIPILPVVARSGKGTDEILSTLSEKHVAPAIPLVLPYGELAETAI
AEIQSLTKDIIPTKQSRWLAVQFLSKNEVTEEFLASNSAFEQLKKIRTELETALEGKLEN
HFHQIRVNYIHDICLTSVEYTRNSDIPLSDKLDKIFTHKFFGIPIFLGIMWLIFQITFTW
VGAPLSDLLDGFISGSLTDWVTSFLTTIGASGFIIDLVAEGIIAGVGGVLVFVPQILVIF
FFISVLEDSGYMARIAVVMDRVMEIFGLNGKAFIPMIIGFGCNVPGIMAARSIEESKERT
LTILVSPFMSCSARLPVYALFVGVFFEKYQALVVLSLYVIGILMALIVTKILSKTLLKKD
NSVFVVELPPYRLPSLKTLWRSTWEKGKGFLRKAGTFIFAGSVIIWLLNYAGPSGLDVPM
GESFLAIIGGMLAPLLVPLGFGTWQAGATLIPGFLAKEVVVSTMAIIYAVGESSMGSVVS
TFYTPLSAYCFMLFILLYIPCLATVAAIRKETSSWKWTAFSVAYPLVTAYVLVFLVYQIG
SLFV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaatacatattgtttacttggaaacccaaatactgggaaaacttctttattt
aatgcgttaacaggctcttatgaatatgtaggaaattggagcggagtgaccgtcgaaaaa
aaagtcggtactttacgttcaaaaacaggaaaattaattgatttacctggtatttatgat
ttaaatcctatttctcgtgatgaaacagtcgtcactagatttttattggaagaaaaattc
gattgtatgttaaacattgttgattcatcgcaaattgaacgcaatttaaatttaaccatc
caactacttgagtttggcgcaccagtcgtgatgggacttaacatggtcgatgtcgctgcg
ggtcgtggcattcatttaaatatccaaaatttagcgaaaaaactgcgcattccgattttg
ccagtagtcgctcgttctggaaaaggtactgatgaaattttatctactttatccgaaaag
catgtggcgccagcgattccgctagtgttaccatacggcgagctcgcggagacagcaatc
gctgaaatccagtcattaacaaaagacatcattcctactaaacaatctcgttggctagca
gttcaatttctttccaaaaatgaagtcacggaagaatttttagcttctaattctgcgttt
gaacaattgaaaaaaatccgaacggaactagaaactgcccttgaaggaaagttagaaaat
catttccaccaaattcgggtaaattacattcatgatatttgtttgacctcagtcgaatat
acgcgcaattcggatattccactatcagacaagctcgataaaatttttacacacaagttt
ttcgggattccgatttttcttggaattatgtggttaatttttcaaataacttttacgtgg
gttggcgcaccgctttccgacttacttgatggttttatcagcggatcgcttacggattgg
gtaacatctttcttaacaacgattggtgcatctggttttatcattgatttggtcgctgaa
ggaattatcgctggcgtgggtggcgttcttgtcttcgttccgcaaattttggttattttc
ttcttcatttctgtcttagaagattcaggatatatggccagaatagcagttgttatggac
cgagtaatggaaattttcggcttaaatgggaaagcttttatcccaatgatcatcgggttt
ggctgtaacgtaccaggaattatggcagcacgttccatcgaagaatccaaagaacgaaca
ctaacgattctagtttctccatttatgtcctgttccgcccgtcttccagtttatgccctt
ttcgttggcgtatttttcgaaaaatatcaagcacttgtcgtattgtcactttacgttatc
ggcattttaatggcactgattgtcactaaaatcctttcgaaaacattacttaaaaaagat
aattccgtgtttgtcgtcgaattaccaccttaccgcttgccatcacttaaaactttatgg
cgtagcacatgggaaaaaggaaaaggcttcttgcgtaaagcagggacatttatttttgca
ggttccgttatcatttggttgttaaactatgctgggccgtccggacttgatgtacctatg
ggtgaaagtttcttagccatcatcggcggaatgttagcaccgttacttgttccactagga
tttggcacttggcaagcaggcgcaactcttattcctggatttttagcaaaagaagtagtc
gtttcaaccatggcaattatttatgctgttggagaaagttccatgggtagtgttgttagc
actttctatacgccactttcggcttattgctttatgttattcatcttgctctatatccct
tgtttagcaacagttgcagccattcgaaaagaaactagttcatggaaatggactgcattt
tcagttgcttatccacttgttacagcttatgttttagtatttcttgtttatcaaattggc
agtctattcgtttaa

DBGET integrated database retrieval system