KEGG   Listeria welshimeri: lwe2424Help
Entry
lwe2424           CDS       T00422                                 

Gene name
mro
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lwe  Listeria welshimeri
Pathway
lwe00010  Glycolysis / Gluconeogenesis
lwe00052  Galactose metabolism
lwe01100  Metabolic pathways
lwe01110  Biosynthesis of secondary metabolites
lwe01120  Microbial metabolism in diverse environments
lwe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lwe2424 (mro)
   00052 Galactose metabolism
    lwe2424 (mro)
Enzymes [BR:lwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     lwe2424 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAK21842
UniProt: A0ALG0
Position
complement(2461653..2462714)
Genome map
AA seq 353 aa AA seqDB search
MIFIEVIKKRFGHFEGETVWQWTMINDHGMKISVLNYGAIITSIETKDKFGEYANISLGF
SDMDDYLAYSPYFGATLGPVAGRITKGQFSLDGEEYQLTQNEGANHRHGGKLNFSKKLWN
VSVEKELDQIVLTFEYTWADGENGYPGNINAHMTYTLNNKNEWIIDYTAHTDKPTIYNPS
NHIYFNLSGKAGSTILPHQLWVNSEKFLPIDKEMLPIGEIRSVENTIFDLRAGREMMEII
KNQDELLQIAGKGLDHTFILKHENGKPDAVLFDPQSGRRLEMETEADSVLVYTSNSMAGD
FEINGKTVPKYAGITLETQGLVDAINHPGFGNIVLRPEKPFKSKTAFRFAVES
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgattttcatcgaagtaattaaaaaacggtttggtcattttgaaggagaaacagtatgg
cagtggacaatgataaatgaccatggtatgaaaattagtgttctaaattatggagcaatt
attacctctattgaaacaaaagataaatttggtgaatatgctaatattagtcttggtttt
tcggatatggatgattatttggcatattctccgtactttggtgctacgcttggtccggtg
gctggtcgtattacgaaaggccaattttctttagatggggaagaatatcaattaactcaa
aatgaaggtgcaaaccatcgacatgggggaaagttgaattttagcaaaaagttatggaat
gtttcagtagaaaaagagttagatcagattgtcctgacttttgaatatacatgggcagat
ggtgaaaatggttacccaggtaatattaatgcgcatatgacgtatacattaaataacaag
aatgaatggattattgattatacggcacatacagataaacctactatttataatccaagt
aatcatatctattttaatttatcaggaaaagctggttccactattttgccacatcagctt
tgggtcaatagtgagaaatttttaccaattgataaagaaatgcttcctattggtgaaatt
cgctctgtagaaaatactatctttgatttgcgggctggacgtgaaatgatggaaattatt
aaaaatcaagatgaactattgcaaatagcggggaaaggcctggatcatacatttatttta
aaacatgaaaatggtaaaccagatgcagtcttatttgatccgcaatctggacgtcgttta
gaaatggaaacagaagctgattccgtattggtttatacgtctaatagcatggctggtgac
tttgaaataaatggtaagactgtgccgaaatatgccggaattacactggaaacacaaggt
ttggtggacgctattaatcatcctggttttggtaatatcgttttaagaccagaaaaacct
tttaaatctaagacagcttttcgttttgctgttgagagttaa

DBGET integrated database retrieval system