KEGG   Listeria weihenstephanensis: UE46_05630Help
Entry
UE46_05630        CDS       T05637                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00480  Glutathione metabolism
lwi00590  Arachidonic acid metabolism
lwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    UE46_05630
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UE46_05630
Enzymes [BR:lwi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     UE46_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like DUF823
Motif
Other DBs
NCBI-ProteinID: AQY50562
UniProt: A0A1S7FT46
Position
1162595..1163068
Genome map
AA seq 157 aa AA seqDB search
MSIFELEQETLHGEKVSLDQYKGDVIIVVNTASKCGFTPQYEELETLYQEYKDKGFTVLG
FPSDSFMNQELDSSNEIEEFCKINYGVTFPLFAKSKVRGSDINPVFEILTKQKKGLLGGG
IKWNFTKFLLDRDGNVVERYAPKDTPLSMKEAIEKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttttgaattagaacaagaaacacttcacggagaaaaagtatcgctagaccag
tataaaggtgacgtcatcatcgtggtaaatacggcgagcaaatgcggttttacaccacaa
tatgaggagttagaaacattatatcaagagtataaggataaaggatttaccgttcttggt
ttcccgtctgatagtttcatgaatcaagaactcgactcatccaacgaaattgaagagttt
tgcaaaatcaactatggtgtgaccttcccacttttcgcaaaatctaaagtacgcggatct
gatataaatcctgtatttgaaatcctaacgaagcagaaaaaaggcttgctaggcggcgga
atcaaatggaacttcacgaaattcctgcttgaccgcgacggcaatgtggtagaacgctac
gcaccaaaagatacaccattatcaatgaaggaagcaatcgagaaactactatag

DBGET integrated database retrieval system