KEGG   Listeria weihenstephanensis: UE46_07825Help
Entry
UE46_07825        CDS       T05637                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00471  D-Glutamine and D-glutamate metabolism
lwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    UE46_07825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lwi01011]
    UE46_07825
Enzymes [BR:lwi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     UE46_07825
Peptidoglycan biosynthesis and degradation proteins [BR:lwi01011]
 Precursor biosynthesis
  Racemase
   UE46_07825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AQY50958
UniProt: A0A1S7FU38
Position
complement(1616140..1616955)
Genome map
AA seq 271 aa AA seqDB search
MKRAIGFIDSGVGGLTVVKEVLKQLPHEQIYYLGDTARCPYGPRDSSEVNQFTWEMTNFL
VDRNIKMLVIACNTATAAALTDIRATLDIPVIGVIQPGSRAALKATQNNRIGVLGTIGTV
QSMAYPRALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKIVAESLLPLKSTKIDTII
LGCTHYPLLKTLIENFMGEHVAVINSGEETASEVSALLDYHDLLDKDDTDVAHRFFTTGS
VSIFQDIAQDWLNIPEMLVEHIKLGNEKGVH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagagcaattggttttattgattcgggcgttggcggcttgactgttgtaaaagaa
gttttaaagcaactgccccatgagcaaatatattatcttggtgacaccgcacgttgcccg
tatggcccacgtgatagtagtgaagtgaatcagtttacttgggagatgacaaatttcctc
gtagatcgcaatataaaaatgctagttatcgcttgtaatactgcaaccgcggcggcgtta
accgacattcgtgctacattagatattcccgttatcggcgttattcaacccggttctaga
gcggcattaaaagcaactcaaaataatcgtattggcgttttaggtacgattggcacggtc
caaagcatggcctatcctcgcgctttaaaaggactaaatcgacgcgttgaagtggattcc
ttggcatgtccaaagtttgtgtctgttgttgaaagtggtgaatataaaagcgcgattgct
aaaaagatcgtcgctgagtccctgcttcctttaaaaagtaccaaaattgatactatcatc
cttggctgcacgcattatcccctactgaaaacattaattgagaattttatgggcgaacat
gttgccgtcattaattctggtgaagaaaccgccagtgaagtcagcgctttgcttgattat
catgatcttttagacaaagatgacaccgatgtcgcgcaccgctttttcacgactggttcc
gtatccatttttcaagatatcgcacaagattggctgaatataccagaaatgctagtagaa
catataaaattaggaaatgaaaagggcgtgcattaa

DBGET integrated database retrieval system